Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 4603483..4603705 Replicon chromosome
Accession NZ_CP029741
Organism Escherichia coli strain AR_0085

Toxin (Protein)


Gene name ldrD Uniprot ID A0A229AEQ8
Locus tag AM464_RS24090 Protein ID WP_000176713.1
Coordinates 4603483..4603590 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 4603638..4603705 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AM464_RS24055 4599341..4600174 + 834 WP_000456454.1 peptide chain release factor N(5)-glutamine methyltransferase -
AM464_RS24060 4600171..4600563 + 393 WP_000200373.1 invasion regulator SirB2 -
AM464_RS24065 4600567..4601376 + 810 WP_001257044.1 invasion regulator SirB1 -
AM464_RS24070 4601412..4602266 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
AM464_RS24075 4602413..4602520 - 108 WP_000170951.1 type I toxin-antitoxin system toxin Ldr family protein -
- 4602568..4602634 + 67 NuclAT_34 - -
- 4602568..4602634 + 67 NuclAT_34 - -
- 4602568..4602634 + 67 NuclAT_34 - -
- 4602568..4602634 + 67 NuclAT_34 - -
- 4602568..4602634 + 67 NuclAT_36 - -
- 4602568..4602634 + 67 NuclAT_36 - -
- 4602568..4602634 + 67 NuclAT_36 - -
- 4602568..4602634 + 67 NuclAT_36 - -
- 4602568..4602634 + 67 NuclAT_38 - -
- 4602568..4602634 + 67 NuclAT_38 - -
- 4602568..4602634 + 67 NuclAT_38 - -
- 4602568..4602634 + 67 NuclAT_38 - -
- 4602568..4602634 + 67 NuclAT_40 - -
- 4602568..4602634 + 67 NuclAT_40 - -
- 4602568..4602634 + 67 NuclAT_40 - -
- 4602568..4602634 + 67 NuclAT_40 - -
- 4602568..4602634 + 67 NuclAT_42 - -
- 4602568..4602634 + 67 NuclAT_42 - -
- 4602568..4602634 + 67 NuclAT_42 - -
- 4602568..4602634 + 67 NuclAT_42 - -
- 4602568..4602634 + 67 NuclAT_44 - -
- 4602568..4602634 + 67 NuclAT_44 - -
- 4602568..4602634 + 67 NuclAT_44 - -
- 4602568..4602634 + 67 NuclAT_44 - -
- 4602570..4602635 + 66 NuclAT_18 - -
- 4602570..4602635 + 66 NuclAT_18 - -
- 4602570..4602635 + 66 NuclAT_18 - -
- 4602570..4602635 + 66 NuclAT_18 - -
- 4602570..4602635 + 66 NuclAT_21 - -
- 4602570..4602635 + 66 NuclAT_21 - -
- 4602570..4602635 + 66 NuclAT_21 - -
- 4602570..4602635 + 66 NuclAT_21 - -
- 4602570..4602635 + 66 NuclAT_24 - -
- 4602570..4602635 + 66 NuclAT_24 - -
- 4602570..4602635 + 66 NuclAT_24 - -
- 4602570..4602635 + 66 NuclAT_24 - -
- 4602570..4602635 + 66 NuclAT_27 - -
- 4602570..4602635 + 66 NuclAT_27 - -
- 4602570..4602635 + 66 NuclAT_27 - -
- 4602570..4602635 + 66 NuclAT_27 - -
- 4602570..4602635 + 66 NuclAT_30 - -
- 4602570..4602635 + 66 NuclAT_30 - -
- 4602570..4602635 + 66 NuclAT_30 - -
- 4602570..4602635 + 66 NuclAT_30 - -
- 4602570..4602635 + 66 NuclAT_33 - -
- 4602570..4602635 + 66 NuclAT_33 - -
- 4602570..4602635 + 66 NuclAT_33 - -
- 4602570..4602635 + 66 NuclAT_33 - -
AM464_RS24080 4602948..4603055 - 108 WP_000170963.1 small toxic polypeptide LdrB -
- 4603103..4603170 + 68 NuclAT_17 - -
- 4603103..4603170 + 68 NuclAT_17 - -
- 4603103..4603170 + 68 NuclAT_17 - -
- 4603103..4603170 + 68 NuclAT_17 - -
- 4603103..4603170 + 68 NuclAT_20 - -
- 4603103..4603170 + 68 NuclAT_20 - -
- 4603103..4603170 + 68 NuclAT_20 - -
- 4603103..4603170 + 68 NuclAT_20 - -
- 4603103..4603170 + 68 NuclAT_23 - -
- 4603103..4603170 + 68 NuclAT_23 - -
- 4603103..4603170 + 68 NuclAT_23 - -
- 4603103..4603170 + 68 NuclAT_23 - -
- 4603103..4603170 + 68 NuclAT_26 - -
- 4603103..4603170 + 68 NuclAT_26 - -
- 4603103..4603170 + 68 NuclAT_26 - -
- 4603103..4603170 + 68 NuclAT_26 - -
- 4603103..4603170 + 68 NuclAT_29 - -
- 4603103..4603170 + 68 NuclAT_29 - -
- 4603103..4603170 + 68 NuclAT_29 - -
- 4603103..4603170 + 68 NuclAT_29 - -
- 4603103..4603170 + 68 NuclAT_32 - -
- 4603103..4603170 + 68 NuclAT_32 - -
- 4603103..4603170 + 68 NuclAT_32 - -
- 4603103..4603170 + 68 NuclAT_32 - -
- 4603104..4603169 + 66 NuclAT_35 - -
- 4603104..4603169 + 66 NuclAT_35 - -
- 4603104..4603169 + 66 NuclAT_35 - -
- 4603104..4603169 + 66 NuclAT_35 - -
- 4603104..4603169 + 66 NuclAT_37 - -
- 4603104..4603169 + 66 NuclAT_37 - -
- 4603104..4603169 + 66 NuclAT_37 - -
- 4603104..4603169 + 66 NuclAT_37 - -
- 4603104..4603169 + 66 NuclAT_39 - -
- 4603104..4603169 + 66 NuclAT_39 - -
- 4603104..4603169 + 66 NuclAT_39 - -
- 4603104..4603169 + 66 NuclAT_39 - -
- 4603104..4603169 + 66 NuclAT_41 - -
- 4603104..4603169 + 66 NuclAT_41 - -
- 4603104..4603169 + 66 NuclAT_41 - -
- 4603104..4603169 + 66 NuclAT_41 - -
- 4603104..4603169 + 66 NuclAT_43 - -
- 4603104..4603169 + 66 NuclAT_43 - -
- 4603104..4603169 + 66 NuclAT_43 - -
- 4603104..4603169 + 66 NuclAT_43 - -
- 4603104..4603169 + 66 NuclAT_45 - -
- 4603104..4603169 + 66 NuclAT_45 - -
- 4603104..4603169 + 66 NuclAT_45 - -
- 4603104..4603169 + 66 NuclAT_45 - -
AM464_RS24090 4603483..4603590 - 108 WP_000176713.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 4603638..4603705 + 68 NuclAT_16 - Antitoxin
- 4603638..4603705 + 68 NuclAT_16 - Antitoxin
- 4603638..4603705 + 68 NuclAT_16 - Antitoxin
- 4603638..4603705 + 68 NuclAT_16 - Antitoxin
- 4603638..4603705 + 68 NuclAT_19 - Antitoxin
- 4603638..4603705 + 68 NuclAT_19 - Antitoxin
- 4603638..4603705 + 68 NuclAT_19 - Antitoxin
- 4603638..4603705 + 68 NuclAT_19 - Antitoxin
- 4603638..4603705 + 68 NuclAT_22 - Antitoxin
- 4603638..4603705 + 68 NuclAT_22 - Antitoxin
- 4603638..4603705 + 68 NuclAT_22 - Antitoxin
- 4603638..4603705 + 68 NuclAT_22 - Antitoxin
- 4603638..4603705 + 68 NuclAT_25 - Antitoxin
- 4603638..4603705 + 68 NuclAT_25 - Antitoxin
- 4603638..4603705 + 68 NuclAT_25 - Antitoxin
- 4603638..4603705 + 68 NuclAT_25 - Antitoxin
- 4603638..4603705 + 68 NuclAT_28 - Antitoxin
- 4603638..4603705 + 68 NuclAT_28 - Antitoxin
- 4603638..4603705 + 68 NuclAT_28 - Antitoxin
- 4603638..4603705 + 68 NuclAT_28 - Antitoxin
- 4603638..4603705 + 68 NuclAT_31 - Antitoxin
- 4603638..4603705 + 68 NuclAT_31 - Antitoxin
- 4603638..4603705 + 68 NuclAT_31 - Antitoxin
- 4603638..4603705 + 68 NuclAT_31 - Antitoxin
AM464_RS24095 4603995..4605095 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
AM464_RS24100 4605365..4605595 + 231 WP_001146444.1 putative cation transport regulator ChaB -
AM464_RS24105 4605753..4606448 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
AM464_RS24110 4606492..4606845 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
AM464_RS24115 4607031..4608425 + 1395 WP_001400233.1 inverse autotransporter invasin YchO -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 4031.79 Da        Isoelectric Point: 11.4779

>T106617 WP_000176713.1 NZ_CP029741:c4603590-4603483 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T106617 NZ_CP029741:c4603590-4603483 [Escherichia coli]
ATGACGCTCACGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 68 bp

>AT106617 NZ_CP029741:4603638-4603705 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A229AEQ8


Antitoxin

Download structure file

References