Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 111882..112121 | Replicon | plasmid pDA33137-178 |
| Accession | NZ_CP029580 | ||
| Organism | Escherichia coli strain DA33137 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A762TWR7 |
| Locus tag | DLJ64_RS27985 | Protein ID | WP_023144756.1 |
| Coordinates | 111882..112016 (-) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 112061..112121 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DLJ64_RS27950 | 107893..108294 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| DLJ64_RS28780 | 108227..108484 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| DLJ64_RS27955 | 108577..109230 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| DLJ64_RS28975 | 109328..109468 | - | 141 | WP_001333237.1 | hypothetical protein | - |
| DLJ64_RS27965 | 110170..111027 | - | 858 | WP_001617855.1 | incFII family plasmid replication initiator RepA | - |
| DLJ64_RS27970 | 111020..111094 | - | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
| DLJ64_RS28980 | 111091..111225 | - | 135 | Protein_130 | protein CopA/IncA | - |
| DLJ64_RS27980 | 111331..111585 | - | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
| DLJ64_RS27985 | 111882..112016 | - | 135 | WP_023144756.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 112061..112121 | + | 61 | NuclAT_1 | - | Antitoxin |
| - | 112061..112121 | + | 61 | NuclAT_1 | - | Antitoxin |
| - | 112061..112121 | + | 61 | NuclAT_1 | - | Antitoxin |
| - | 112061..112121 | + | 61 | NuclAT_1 | - | Antitoxin |
| DLJ64_RS27990 | 112088..112374 | - | 287 | Protein_133 | DUF2726 domain-containing protein | - |
| DLJ64_RS28000 | 112887..113099 | - | 213 | WP_013023861.1 | hypothetical protein | - |
| DLJ64_RS28005 | 113230..113790 | - | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
| DLJ64_RS28010 | 113845..114591 | - | 747 | WP_000205718.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | qacE / blaCTX-M-14 / aadA5 / sul1 / mph(A) / erm(B) / aac(3)-IId / blaTEM-1B / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / cmlA1 | senB | 1..178078 | 178078 | |
| - | inside | Integron | - | senB | 27..178076 | 178049 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T105902 WP_023144756.1 NZ_CP029580:c112016-111882 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
>T105902 NZ_CP029580:c112016-111882 [Escherichia coli]
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA
Antitoxin
Download Length: 61 bp
>AT105902 NZ_CP029580:112061-112121 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|