Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2125217..2125438 Replicon chromosome
Accession NZ_CP029328
Organism Escherichia coli strain A1

Toxin (Protein)


Gene name ldrD Uniprot ID E0IV43
Locus tag AOY52_RS10210 Protein ID WP_000170926.1
Coordinates 2125217..2125324 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2125377..2125438 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AOY52_RS10180 (2120526) 2120526..2121608 + 1083 WP_000804726.1 peptide chain release factor 1 -
AOY52_RS10185 (2121608) 2121608..2122441 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
AOY52_RS10190 (2122438) 2122438..2122830 + 393 WP_000200374.1 invasion regulator SirB2 -
AOY52_RS10195 (2122834) 2122834..2123643 + 810 WP_001257044.1 invasion regulator SirB1 -
AOY52_RS10200 (2123679) 2123679..2124533 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
AOY52_RS10205 (2124682) 2124682..2124789 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- (2124839) 2124839..2124902 + 64 NuclAT_22 - -
- (2124839) 2124839..2124902 + 64 NuclAT_22 - -
- (2124839) 2124839..2124902 + 64 NuclAT_22 - -
- (2124839) 2124839..2124902 + 64 NuclAT_22 - -
- (2124839) 2124839..2124902 + 64 NuclAT_25 - -
- (2124839) 2124839..2124902 + 64 NuclAT_25 - -
- (2124839) 2124839..2124902 + 64 NuclAT_25 - -
- (2124839) 2124839..2124902 + 64 NuclAT_25 - -
- (2124839) 2124839..2124902 + 64 NuclAT_28 - -
- (2124839) 2124839..2124902 + 64 NuclAT_28 - -
- (2124839) 2124839..2124902 + 64 NuclAT_28 - -
- (2124839) 2124839..2124902 + 64 NuclAT_28 - -
- (2124839) 2124839..2124902 + 64 NuclAT_31 - -
- (2124839) 2124839..2124902 + 64 NuclAT_31 - -
- (2124839) 2124839..2124902 + 64 NuclAT_31 - -
- (2124839) 2124839..2124902 + 64 NuclAT_31 - -
- (2124839) 2124839..2124902 + 64 NuclAT_34 - -
- (2124839) 2124839..2124902 + 64 NuclAT_34 - -
- (2124839) 2124839..2124902 + 64 NuclAT_34 - -
- (2124839) 2124839..2124902 + 64 NuclAT_34 - -
- (2124839) 2124839..2124902 + 64 NuclAT_37 - -
- (2124839) 2124839..2124902 + 64 NuclAT_37 - -
- (2124839) 2124839..2124902 + 64 NuclAT_37 - -
- (2124839) 2124839..2124902 + 64 NuclAT_37 - -
- (2124837) 2124837..2124903 + 67 NuclAT_38 - -
- (2124837) 2124837..2124903 + 67 NuclAT_38 - -
- (2124837) 2124837..2124903 + 67 NuclAT_38 - -
- (2124837) 2124837..2124903 + 67 NuclAT_38 - -
- (2124837) 2124837..2124903 + 67 NuclAT_40 - -
- (2124837) 2124837..2124903 + 67 NuclAT_40 - -
- (2124837) 2124837..2124903 + 67 NuclAT_40 - -
- (2124837) 2124837..2124903 + 67 NuclAT_40 - -
- (2124837) 2124837..2124903 + 67 NuclAT_42 - -
- (2124837) 2124837..2124903 + 67 NuclAT_42 - -
- (2124837) 2124837..2124903 + 67 NuclAT_42 - -
- (2124837) 2124837..2124903 + 67 NuclAT_42 - -
AOY52_RS10210 (2125217) 2125217..2125324 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2125377) 2125377..2125438 + 62 NuclAT_21 - Antitoxin
- (2125377) 2125377..2125438 + 62 NuclAT_21 - Antitoxin
- (2125377) 2125377..2125438 + 62 NuclAT_21 - Antitoxin
- (2125377) 2125377..2125438 + 62 NuclAT_21 - Antitoxin
- (2125377) 2125377..2125438 + 62 NuclAT_24 - Antitoxin
- (2125377) 2125377..2125438 + 62 NuclAT_24 - Antitoxin
- (2125377) 2125377..2125438 + 62 NuclAT_24 - Antitoxin
- (2125377) 2125377..2125438 + 62 NuclAT_24 - Antitoxin
- (2125377) 2125377..2125438 + 62 NuclAT_27 - Antitoxin
- (2125377) 2125377..2125438 + 62 NuclAT_27 - Antitoxin
- (2125377) 2125377..2125438 + 62 NuclAT_27 - Antitoxin
- (2125377) 2125377..2125438 + 62 NuclAT_27 - Antitoxin
- (2125377) 2125377..2125438 + 62 NuclAT_30 - Antitoxin
- (2125377) 2125377..2125438 + 62 NuclAT_30 - Antitoxin
- (2125377) 2125377..2125438 + 62 NuclAT_30 - Antitoxin
- (2125377) 2125377..2125438 + 62 NuclAT_30 - Antitoxin
- (2125377) 2125377..2125438 + 62 NuclAT_33 - Antitoxin
- (2125377) 2125377..2125438 + 62 NuclAT_33 - Antitoxin
- (2125377) 2125377..2125438 + 62 NuclAT_33 - Antitoxin
- (2125377) 2125377..2125438 + 62 NuclAT_33 - Antitoxin
- (2125377) 2125377..2125438 + 62 NuclAT_36 - Antitoxin
- (2125377) 2125377..2125438 + 62 NuclAT_36 - Antitoxin
- (2125377) 2125377..2125438 + 62 NuclAT_36 - Antitoxin
- (2125377) 2125377..2125438 + 62 NuclAT_36 - Antitoxin
- (2125377) 2125377..2125439 + 63 NuclAT_39 - -
- (2125377) 2125377..2125439 + 63 NuclAT_39 - -
- (2125377) 2125377..2125439 + 63 NuclAT_39 - -
- (2125377) 2125377..2125439 + 63 NuclAT_39 - -
- (2125377) 2125377..2125439 + 63 NuclAT_41 - -
- (2125377) 2125377..2125439 + 63 NuclAT_41 - -
- (2125377) 2125377..2125439 + 63 NuclAT_41 - -
- (2125377) 2125377..2125439 + 63 NuclAT_41 - -
- (2125377) 2125377..2125439 + 63 NuclAT_43 - -
- (2125377) 2125377..2125439 + 63 NuclAT_43 - -
- (2125377) 2125377..2125439 + 63 NuclAT_43 - -
- (2125377) 2125377..2125439 + 63 NuclAT_43 - -
AOY52_RS10215 (2125753) 2125753..2125860 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- (2125908) 2125908..2125973 + 66 NuclAT_20 - -
- (2125908) 2125908..2125973 + 66 NuclAT_20 - -
- (2125908) 2125908..2125973 + 66 NuclAT_20 - -
- (2125908) 2125908..2125973 + 66 NuclAT_20 - -
- (2125908) 2125908..2125973 + 66 NuclAT_23 - -
- (2125908) 2125908..2125973 + 66 NuclAT_23 - -
- (2125908) 2125908..2125973 + 66 NuclAT_23 - -
- (2125908) 2125908..2125973 + 66 NuclAT_23 - -
- (2125908) 2125908..2125973 + 66 NuclAT_26 - -
- (2125908) 2125908..2125973 + 66 NuclAT_26 - -
- (2125908) 2125908..2125973 + 66 NuclAT_26 - -
- (2125908) 2125908..2125973 + 66 NuclAT_26 - -
- (2125908) 2125908..2125973 + 66 NuclAT_29 - -
- (2125908) 2125908..2125973 + 66 NuclAT_29 - -
- (2125908) 2125908..2125973 + 66 NuclAT_29 - -
- (2125908) 2125908..2125973 + 66 NuclAT_29 - -
- (2125908) 2125908..2125973 + 66 NuclAT_32 - -
- (2125908) 2125908..2125973 + 66 NuclAT_32 - -
- (2125908) 2125908..2125973 + 66 NuclAT_32 - -
- (2125908) 2125908..2125973 + 66 NuclAT_32 - -
- (2125908) 2125908..2125973 + 66 NuclAT_35 - -
- (2125908) 2125908..2125973 + 66 NuclAT_35 - -
- (2125908) 2125908..2125973 + 66 NuclAT_35 - -
- (2125908) 2125908..2125973 + 66 NuclAT_35 - -
- (2125908) 2125908..2125975 + 68 NuclAT_14 - -
- (2125908) 2125908..2125975 + 68 NuclAT_14 - -
- (2125908) 2125908..2125975 + 68 NuclAT_14 - -
- (2125908) 2125908..2125975 + 68 NuclAT_14 - -
- (2125908) 2125908..2125975 + 68 NuclAT_15 - -
- (2125908) 2125908..2125975 + 68 NuclAT_15 - -
- (2125908) 2125908..2125975 + 68 NuclAT_15 - -
- (2125908) 2125908..2125975 + 68 NuclAT_15 - -
- (2125908) 2125908..2125975 + 68 NuclAT_16 - -
- (2125908) 2125908..2125975 + 68 NuclAT_16 - -
- (2125908) 2125908..2125975 + 68 NuclAT_16 - -
- (2125908) 2125908..2125975 + 68 NuclAT_16 - -
- (2125908) 2125908..2125975 + 68 NuclAT_17 - -
- (2125908) 2125908..2125975 + 68 NuclAT_17 - -
- (2125908) 2125908..2125975 + 68 NuclAT_17 - -
- (2125908) 2125908..2125975 + 68 NuclAT_17 - -
- (2125908) 2125908..2125975 + 68 NuclAT_18 - -
- (2125908) 2125908..2125975 + 68 NuclAT_18 - -
- (2125908) 2125908..2125975 + 68 NuclAT_18 - -
- (2125908) 2125908..2125975 + 68 NuclAT_18 - -
- (2125908) 2125908..2125975 + 68 NuclAT_19 - -
- (2125908) 2125908..2125975 + 68 NuclAT_19 - -
- (2125908) 2125908..2125975 + 68 NuclAT_19 - -
- (2125908) 2125908..2125975 + 68 NuclAT_19 - -
AOY52_RS10220 (2126265) 2126265..2127365 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
AOY52_RS10225 (2127635) 2127635..2127865 + 231 WP_001146442.1 putative cation transport regulator ChaB -
AOY52_RS10230 (2128023) 2128023..2128718 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
AOY52_RS10235 (2128762) 2128762..2129115 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.84 Da        Isoelectric Point: 11.6501

>T105441 WP_000170926.1 NZ_CP029328:c2125324-2125217 [Escherichia coli]
MTLAKFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T105441 NZ_CP029328:c2125324-2125217 [Escherichia coli]
ATGACGCTCGCGAAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 62 bp

>AT105441 NZ_CP029328:2125377-2125438 [Escherichia coli]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGAGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y1K9

Antitoxin

Download structure file

References