Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2801133..2801353 Replicon chromosome
Accession NZ_CP028747
Organism Escherichia coli strain A28

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag AOY81_RS13720 Protein ID WP_000170965.1
Coordinates 2801246..2801353 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2801133..2801199 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AOY81_RS13695 2796412..2797806 - 1395 WP_000086213.1 inverse autotransporter invasin YchO -
AOY81_RS13700 2797991..2798344 + 354 WP_001169671.1 DsrE/F sulfur relay family protein YchN -
AOY81_RS13705 2798388..2799083 - 696 WP_240760377.1 glutathione-specific gamma-glutamylcyclotransferase -
AOY81_RS13710 2799241..2799471 - 231 WP_001146442.1 putative cation transport regulator ChaB -
AOY81_RS13715 2799741..2800841 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 2801133..2801199 - 67 - - Antitoxin
AOY81_RS13720 2801246..2801353 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2801666..2801729 - 64 NuclAT_33 - -
- 2801666..2801729 - 64 NuclAT_33 - -
- 2801666..2801729 - 64 NuclAT_33 - -
- 2801666..2801729 - 64 NuclAT_33 - -
- 2801666..2801729 - 64 NuclAT_35 - -
- 2801666..2801729 - 64 NuclAT_35 - -
- 2801666..2801729 - 64 NuclAT_35 - -
- 2801666..2801729 - 64 NuclAT_35 - -
- 2801666..2801729 - 64 NuclAT_37 - -
- 2801666..2801729 - 64 NuclAT_37 - -
- 2801666..2801729 - 64 NuclAT_37 - -
- 2801666..2801729 - 64 NuclAT_37 - -
- 2801666..2801729 - 64 NuclAT_39 - -
- 2801666..2801729 - 64 NuclAT_39 - -
- 2801666..2801729 - 64 NuclAT_39 - -
- 2801666..2801729 - 64 NuclAT_39 - -
- 2801666..2801729 - 64 NuclAT_41 - -
- 2801666..2801729 - 64 NuclAT_41 - -
- 2801666..2801729 - 64 NuclAT_41 - -
- 2801666..2801729 - 64 NuclAT_41 - -
- 2801666..2801729 - 64 NuclAT_43 - -
- 2801666..2801729 - 64 NuclAT_43 - -
- 2801666..2801729 - 64 NuclAT_43 - -
- 2801666..2801729 - 64 NuclAT_43 - -
- 2801667..2801729 - 63 NuclAT_45 - -
- 2801667..2801729 - 63 NuclAT_45 - -
- 2801667..2801729 - 63 NuclAT_45 - -
- 2801667..2801729 - 63 NuclAT_45 - -
- 2801667..2801729 - 63 NuclAT_48 - -
- 2801667..2801729 - 63 NuclAT_48 - -
- 2801667..2801729 - 63 NuclAT_48 - -
- 2801667..2801729 - 63 NuclAT_48 - -
- 2801667..2801729 - 63 NuclAT_51 - -
- 2801667..2801729 - 63 NuclAT_51 - -
- 2801667..2801729 - 63 NuclAT_51 - -
- 2801667..2801729 - 63 NuclAT_51 - -
- 2801668..2801729 - 62 NuclAT_15 - -
- 2801668..2801729 - 62 NuclAT_15 - -
- 2801668..2801729 - 62 NuclAT_15 - -
- 2801668..2801729 - 62 NuclAT_15 - -
- 2801668..2801729 - 62 NuclAT_18 - -
- 2801668..2801729 - 62 NuclAT_18 - -
- 2801668..2801729 - 62 NuclAT_18 - -
- 2801668..2801729 - 62 NuclAT_18 - -
- 2801668..2801729 - 62 NuclAT_21 - -
- 2801668..2801729 - 62 NuclAT_21 - -
- 2801668..2801729 - 62 NuclAT_21 - -
- 2801668..2801729 - 62 NuclAT_21 - -
- 2801668..2801729 - 62 NuclAT_24 - -
- 2801668..2801729 - 62 NuclAT_24 - -
- 2801668..2801729 - 62 NuclAT_24 - -
- 2801668..2801729 - 62 NuclAT_24 - -
- 2801668..2801729 - 62 NuclAT_27 - -
- 2801668..2801729 - 62 NuclAT_27 - -
- 2801668..2801729 - 62 NuclAT_27 - -
- 2801668..2801729 - 62 NuclAT_27 - -
- 2801668..2801729 - 62 NuclAT_30 - -
- 2801668..2801729 - 62 NuclAT_30 - -
- 2801668..2801729 - 62 NuclAT_30 - -
- 2801668..2801729 - 62 NuclAT_30 - -
AOY81_RS13725 2801782..2801889 + 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2802203..2802269 - 67 NuclAT_44 - -
- 2802203..2802269 - 67 NuclAT_44 - -
- 2802203..2802269 - 67 NuclAT_44 - -
- 2802203..2802269 - 67 NuclAT_44 - -
- 2802203..2802269 - 67 NuclAT_47 - -
- 2802203..2802269 - 67 NuclAT_47 - -
- 2802203..2802269 - 67 NuclAT_47 - -
- 2802203..2802269 - 67 NuclAT_47 - -
- 2802203..2802269 - 67 NuclAT_50 - -
- 2802203..2802269 - 67 NuclAT_50 - -
- 2802203..2802269 - 67 NuclAT_50 - -
- 2802203..2802269 - 67 NuclAT_50 - -
- 2802204..2802267 - 64 NuclAT_16 - -
- 2802204..2802267 - 64 NuclAT_16 - -
- 2802204..2802267 - 64 NuclAT_16 - -
- 2802204..2802267 - 64 NuclAT_16 - -
- 2802204..2802267 - 64 NuclAT_19 - -
- 2802204..2802267 - 64 NuclAT_19 - -
- 2802204..2802267 - 64 NuclAT_19 - -
- 2802204..2802267 - 64 NuclAT_19 - -
- 2802204..2802267 - 64 NuclAT_22 - -
- 2802204..2802267 - 64 NuclAT_22 - -
- 2802204..2802267 - 64 NuclAT_22 - -
- 2802204..2802267 - 64 NuclAT_22 - -
- 2802204..2802267 - 64 NuclAT_25 - -
- 2802204..2802267 - 64 NuclAT_25 - -
- 2802204..2802267 - 64 NuclAT_25 - -
- 2802204..2802267 - 64 NuclAT_25 - -
- 2802204..2802267 - 64 NuclAT_28 - -
- 2802204..2802267 - 64 NuclAT_28 - -
- 2802204..2802267 - 64 NuclAT_28 - -
- 2802204..2802267 - 64 NuclAT_28 - -
- 2802204..2802267 - 64 NuclAT_31 - -
- 2802204..2802267 - 64 NuclAT_31 - -
- 2802204..2802267 - 64 NuclAT_31 - -
- 2802204..2802267 - 64 NuclAT_31 - -
AOY81_RS13730 2802317..2802424 + 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
AOY81_RS13735 2802573..2803427 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
AOY81_RS13740 2803463..2804272 - 810 WP_001257044.1 invasion regulator SirB1 -
AOY81_RS13745 2804276..2804668 - 393 WP_240760378.1 invasion regulator SirB2 -
AOY81_RS13750 2804665..2805498 - 834 WP_000456471.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T103476 WP_000170965.1 NZ_CP028747:2801246-2801353 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T103476 NZ_CP028747:2801246-2801353 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT103476 NZ_CP028747:c2801199-2801133 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References