Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 42293..42546 Replicon plasmid pCRKP18622-KPC
Accession NZ_CP027866
Organism Klebsiella pneumoniae subsp. pneumoniae strain CRKP18622

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag C7K64_RS27965 Protein ID WP_001312851.1
Coordinates 42293..42442 (-) Length 50 a.a.

Antitoxin (RNA)


Gene name sok
Locus tag -
Coordinates 42487..42546 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C7K64_RS27935 (38315) 38315..38716 - 402 WP_001398199.1 type II toxin-antitoxin system toxin endoribonuclease PemK -
C7K64_RS27940 (38649) 38649..38906 - 258 WP_000557619.1 type II toxin-antitoxin system antitoxin PemI -
C7K64_RS27945 (38999) 38999..39652 - 654 WP_000616807.1 CPBP family intramembrane metalloprotease -
C7K64_RS27950 (40591) 40591..41448 - 858 WP_016240488.1 incFII family plasmid replication initiator RepA -
C7K64_RS27955 (41441) 41441..41515 - 75 WP_001365705.1 RepA leader peptide Tap -
C7K64_RS27960 (41760) 41760..42008 - 249 WP_000083839.1 replication regulatory protein RepA -
C7K64_RS27965 (42293) 42293..42442 - 150 WP_001312851.1 Hok/Gef family protein Toxin
- (42487) 42487..42546 + 60 NuclAT_1 - Antitoxin
- (42487) 42487..42546 + 60 NuclAT_1 - Antitoxin
- (42487) 42487..42546 + 60 NuclAT_1 - Antitoxin
- (42487) 42487..42546 + 60 NuclAT_1 - Antitoxin
C7K64_RS27970 (42689) 42689..43162 - 474 WP_016240489.1 hypothetical protein -
C7K64_RS27975 (43317) 43317..43907 - 591 WP_033807967.1 DUF2726 domain-containing protein -
C7K64_RS27980 (43945) 43945..44154 - 210 WP_001298565.1 hemolysin expression modulator Hha -
C7K64_RS27985 (44200) 44200..44661 - 462 WP_001233838.1 thermonuclease family protein -
C7K64_RS27990 (44906) 44906..45118 - 213 WP_001309245.1 ANR family transcriptional regulator -
C7K64_RS27995 (45247) 45247..45807 - 561 WP_000139321.1 fertility inhibition protein FinO -
C7K64_RS28000 (45910) 45910..46770 - 861 WP_000704523.1 alpha/beta hydrolase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid cmlA1 / qacE / blaCTX-M-14 / blaTEM-1B / blaKPC-2 / sitABCD iutA / iucD / iucC / iucB / iucA 1..134794 134794
- inside IScluster/Tn cmlA1 / qacE / blaCTX-M-14 / blaTEM-1B / blaKPC-2 - 592..37984 37392


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T100408 WP_001312851.1 NZ_CP027866:c42442-42293 [Klebsiella pneumoniae subsp. pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

>T100408 NZ_CP027866:c42442-42293 [Klebsiella pneumoniae subsp. pneumoniae]
ATGACGAAGTATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA

Antitoxin


Download         Length: 60 bp

>AT100408 NZ_CP027866:42487-42546 [Klebsiella pneumoniae subsp. pneumoniae]
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References