TAfinder detailed results

Overview


Job ID wrVbGpMxFf
Sequence name NZ_CP026085.1 Escherichia coli strain DH5alpha chromosome, complete genome
Predicted type II

Orphan Antitoxin (Protein)


Predicted family EcnA (AT10118) Predicted domain -
Locus tag orf4076 Length 48 a.a.
Coordinates 4342309..4342455 (-)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
orf4065 4338492..4339226 + 735 ORF4065 Predicted ORF by PRODIGAL Version 1.20 -
orf4066 4339237..4339632 + 396 ORF4066 Predicted ORF by PRODIGAL Version 1.20 -
orf4067 4339643..4340002 + 360 ORF4067 Predicted ORF by PRODIGAL Version 1.20 -
orf4068 4340065..4341198 + 1134 ORF4068 Predicted ORF by PRODIGAL Version 1.20 -
orf4069 4341287..4341820 + 534 ORF4069 Predicted ORF by PRODIGAL Version 1.20 -
orf4070 4341817..4342134 - 318 ORF4070 Predicted ORF by PRODIGAL Version 1.20 -
orf4071 4342309..4342455 - 147 ORF4071 Predicted ORF by PRODIGAL Version 1.20 Antitoxin
orf4072 4342566..4342691 - 126 ORF4072 Predicted ORF by PRODIGAL Version 1.20 -
orf4073 4342743..4343309 - 567 ORF4073 Predicted ORF by PRODIGAL Version 1.20 -
orf4074 4343351..4344379 + 1029 ORF4074 Predicted ORF by PRODIGAL Version 1.20 -
orf4075 4344769..4345638 + 870 ORF4075 Predicted ORF by PRODIGAL Version 1.20 -
orf4076 4345688..4346041 - 354 ORF4076 Predicted ORF by PRODIGAL Version 1.20 -

Domains


The domains were predicted by HMMER and were sorted by score.

Orphan Antitoxin


No domain identified.



Sequences


Orphan Antitoxin        


Download         Length:         Molecular weight: 4809.53 Da        Isoelectric Point: 7.9947

>ORF4071 Orphan_TA_98 Antitoxin
MVKKTIAAIFSVLVLSTVLTACNTTRGVGEDISDGGNAISGAATKAQQ

Download         Length: 147 bp

>ORF4071 Orphan_TA_98 Antitoxin
TTATTGCTGCGCTTTCGTTGCTGCACCAGAAATCGCGTTACCGCCATCAGAAATGTCTTC
ACCAACGCCACGCGTGGTGTTGCAGGCAGTTAATACTGTTGAAAGCACCAGAACAGAAAA
GATCGCTGCAATTGTCTTCTTCACCAT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
AT10118 Xanthomonas axonopodis pv. citri str. 306

31.818

88

0.292