TAfinder detailed results
Overview
| Job ID | 9mizKMmBqU | ||
| Sequence name | Escherichia coli strain DH5alpha chromosome, complete genome. | ||
| Predicted type | I | ||
Orphan Toxin (Protein)
| Predicted family | hokW (T10039) | Predicted domain | - |
| Locus tag | C1467_RS13470 | Length | 51 a.a. |
| Coordinates | 2583059..2583214 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C1467_RS25025 | 2578663..2578845 | - | 183 | WP_133301706.1 | hypothetical protein | - |
| C1467_RS13405 | 2578860..2579237 | - | 378 | WP_000014545.1 | M15 family metallopeptidase | - |
| C1467_RS13410 | 2579240..2579515 | - | 276 | WP_000950573.1 | phage holin family protein | - |
| C1467_RS13415 | 2579505..2579897 | - | 393 | WP_001349882.1 | putative holin | - |
| C1467_RS13430 | 2581168..2581704 | - | 537 | WP_000640164.1 | DUF1133 family protein | - |
| C1467_RS13435 | 2581701..2581991 | - | 291 | WP_000228041.1 | DUF1364 domain-containing protein | - |
| C1467_RS13440 | 2581991..2582590 | - | 600 | WP_000940320.1 | DUF1367 family protein | - |
| C1467_RS13445 | 2583059..2583214 | - | 156 | WP_000813259.1 | Hok/Gef family protein | Toxin |
| C1467_RS13455 | 2583845..2584822 | - | 978 | WP_000064766.1 | hypothetical protein | - |
| C1467_RS13460 | 2584819..2585928 | - | 1110 | WP_000569066.1 | DUF3696 domain-containing protein | - |
| C1467_RS13465 | 2585921..2587048 | - | 1128 | WP_000228824.1 | DUF262 domain-containing protein | - |
| C1467_RS13470 | 2587232..2587654 | - | 423 | WP_001151237.1 | DUF977 family protein | - |
Domains
The domains were predicted by HMMER and were sorted by score.
Orphan Toxin
No domain identified.
Sequences
Orphan Toxin
Download Length: Molecular weight: 5795.96 Da Isoelectric Point: 7.7951
>WP_000813259.1 Orphan_TA_60 Toxin
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESRE*
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESRE*
Download Length: 156 bp
>WP_000813259.1 Orphan_TA_60 Toxin
TTACTCTCTAGATTCGTAGTCTACGAAGACAGCGACCTCCGTCTGGCCGGTTCGGATTCG
TACCTCGCAGAGGTCTTTCCTCGTTACCAGTGCCGTCACAATGACGGTTAAACAGATGAC
GATCAGGGCGATTAACATCGCCTTTTGCTGCTTCAT
TTACTCTCTAGATTCGTAGTCTACGAAGACAGCGACCTCCGTCTGGCCGGTTCGGATTCG
TACCTCGCAGAGGTCTTTCCTCGTTACCAGTGCCGTCACAATGACGGTTAAACAGATGAC
GATCAGGGCGATTAACATCGCCTTTTGCTGCTTCAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| T10039 | Escherichia coli O157:H7 str. Sakai |
96.078 |
100 |
0.942 |
| T10209 | Escherichia coli strain ECOR24 |
79.592 |
98 |
0.75 |
| T10210 | Hafnia alvei |
42.857 |
94.231 |
0.404 |
| T6324 | Escherichia coli |
44 |
96.154 |
0.423 |
| T6363 | uncultured bacterium |
44 |
96.154 |
0.423 |
| T10208 | Escherichia coli C |
39.583 |
96 |
0.365 |
| T6369 | Escherichia coli K-12 |
42.553 |
95.918 |
0.385 |
| T10124 | Erwinia amylovora ATCC 49946 |
55.556 |
84.375 |
0.288 |
| T6370 | Escherichia coli |
33.333 |
96 |
0.308 |