TAfinder detailed results
Overview
| Job ID | 9mizKMmBqU | ||
| Sequence name | Escherichia coli strain DH5alpha chromosome, complete genome. | ||
| Predicted type | I | ||
Orphan Toxin (Protein)
| Predicted family | hok (T6324) | Predicted domain | - |
| Locus tag | C1467_RS13060 | Length | 49 a.a. |
| Coordinates | 2501130..2501279 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C1467_RS13020 | 2496570..2497913 | - | 1344 | WP_000013789.1 | VOC family protein | - |
| C1467_RS13025 | 2498130..2499053 | + | 924 | WP_000414564.1 | LysR substrate-binding domain-containing protein | - |
| C1467_RS13030 | 2499091..2500731 | - | 1641 | WP_001098531.1 | methyl-accepting chemotaxis protein Trg | - |
| C1467_RS13035 | 2501130..2501279 | + | 150 | WP_001320773.1 | type I toxin-antitoxin system toxin HokB | Toxin |
| C1467_RS25335 | 2501257..2501325 | - | 69 | WP_212591405.1 | hypothetical protein | - |
| C1467_RS13040 | 2501351..2501524 | - | 174 | WP_000731833.1 | periplasmic protein | - |
| C1467_RS13045 | 2501769..2502299 | - | 531 | WP_001307188.1 | cytochrome b561 | - |
| C1467_RS13050 | 2502488..2503489 | + | 1002 | WP_000048667.1 | type I glyceraldehyde-3-phosphate dehydrogenase | - |
| C1467_RS13055 | 2503531..2504970 | - | 1440 | WP_000115944.1 | aldehyde dehydrogenase | - |
| C1467_RS13060 | 2505167..2505967 | - | 801 | WP_001027964.1 | DUF218 domain-containing protein YdcF | - |
Domains
The domains were predicted by HMMER and were sorted by score.
Orphan Toxin
No domain identified.
Sequences
Orphan Toxin
Download Length: Molecular weight: 5625.81 Da Isoelectric Point: 8.2848
>WP_001320773.1 Orphan_TA_57 Toxin
MKHNPLVVCLLIICITILTFTLLTRQTLYELRFRDGDKEVAALMACTSR*
MKHNPLVVCLLIICITILTFTLLTRQTLYELRFRDGDKEVAALMACTSR*
Download Length: 150 bp
>WP_001320773.1 Orphan_TA_57 Toxin
ATGAAGCACAACCCTCTGGTGGTGTGTCTGCTCATTATCTGCATTACGATTCTGACATTC
ACACTCCTGACCCGACAAACGCTCTACGAACTGCGGTTCCGGGACGGTGATAAGGAGGTT
GCTGCGCTCATGGCCTGCACGTCCAGGTAA
ATGAAGCACAACCCTCTGGTGGTGTGTCTGCTCATTATCTGCATTACGATTCTGACATTC
ACACTCCTGACCCGACAAACGCTCTACGAACTGCGGTTCCGGGACGGTGATAAGGAGGTT
GCTGCGCTCATGGCCTGCACGTCCAGGTAA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| T6324 | Escherichia coli |
54.167 |
92.308 |
0.52 |
| T6363 | uncultured bacterium |
54.167 |
92.308 |
0.52 |
| T10209 | Escherichia coli strain ECOR24 |
39.583 |
96 |
0.38 |
| T10208 | Escherichia coli C |
38.298 |
94 |
0.36 |
| T10124 | Erwinia amylovora ATCC 49946 |
58.621 |
90.625 |
0.34 |
| T10210 | Hafnia alvei |
40.909 |
84.615 |
0.36 |
| T10039 | Escherichia coli O157:H7 str. Sakai |
34.884 |
84.314 |
0.3 |
| T6370 | Escherichia coli |
33.333 |
90 |
0.3 |
| T6369 | Escherichia coli K-12 |
37.5 |
81.633 |
0.3 |