TAfinder detailed results
Overview
| Job ID | 9mizKMmBqU | ||
| Sequence name | Escherichia coli strain DH5alpha chromosome, complete genome. | ||
| Predicted type | II | ||
Orphan Antitoxin (Protein)
| Predicted family | higA (AT325) | Predicted domain | PF13560 (HTH_31) |
| Locus tag | C1467_RS07570 | Length | 71 a.a. |
| Coordinates | 1449804..1450019 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C1467_RS07470 | 1445263..1445778 | - | 516 | WP_000168259.1 | single-stranded DNA-binding protein | - |
| C1467_RS07475 | 1445779..1446486 | - | 708 | WP_000365276.1 | Rad52/Rad22 family DNA repair protein | - |
| C1467_RS25170 | 1446741..1446911 | - | 171 | WP_001183768.1 | hypothetical protein | - |
| C1467_RS07480 | 1447097..1447285 | - | 189 | WP_000865176.1 | hypothetical protein | - |
| C1467_RS07485 | 1447285..1447614 | - | 330 | WP_000657742.1 | hypothetical protein | - |
| C1467_RS07490 | 1447667..1448032 | - | 366 | WP_000392415.1 | hypothetical protein | - |
| C1467_RS07495 | 1448090..1448368 | - | 279 | WP_000804697.1 | hypothetical protein | - |
| C1467_RS07500 | 1448371..1448679 | - | 309 | WP_000216180.1 | hypothetical protein | - |
| C1467_RS07510 | 1449033..1449686 | - | 654 | WP_000872381.1 | LexA family transcriptional regulator | - |
| C1467_RS07515 | 1449804..1450019 | + | 216 | WP_000067727.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| C1467_RS07520 | 1450129..1450425 | + | 297 | WP_000438534.1 | CII family transcriptional regulator | - |
| C1467_RS07525 | 1450458..1450604 | + | 147 | WP_000166207.1 | DUF2740 family protein | - |
| C1467_RS07530 | 1450597..1451496 | + | 900 | WP_000065676.1 | hypothetical protein | - |
| C1467_RS07535 | 1451486..1452922 | + | 1437 | WP_000131504.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| C1467_RS07545 | 1453007..1453276 | + | 270 | WP_001294157.1 | hypothetical protein | - |
| C1467_RS07550 | 1453317..1453763 | + | 447 | WP_000810178.1 | recombination protein NinB | - |
| C1467_RS07555 | 1453760..1454287 | + | 528 | WP_000153270.1 | phage N-6-adenine-methyltransferase | - |
| C1467_RS07560 | 1454284..1454460 | + | 177 | WP_001254255.1 | NinE family protein | - |
| C1467_RS07565 | 1454463..1454822 | + | 360 | WP_000386657.1 | DUF2591 family protein | - |
| C1467_RS07570 | 1454822..1454998 | + | 177 | WP_000950973.1 | protein NinF | - |
Domains
The domains were predicted by HMMER and were sorted by score.
Orphan Antitoxin
No domain identified.
Sequences
Orphan Antitoxin
Download Length: Molecular weight: 7770.99 Da Isoelectric Point: 9.9220
>WP_000067727.1 Orphan_TA_31 Antitoxin
MSNLRKYRESLNISQTTLAKAVGCTQGAIGHWESGRRFPDLKTCRALVACLNKLGAKVSL
DDVFPPEHKAA*
MSNLRKYRESLNISQTTLAKAVGCTQGAIGHWESGRRFPDLKTCRALVACLNKLGAKVSL
DDVFPPEHKAA*
Download Length: 216 bp
>WP_000067727.1 Orphan_TA_31 Antitoxin
ATGAGCAACCTACGAAAATATCGAGAGTCACTGAATATCTCTCAAACAACACTTGCTAAG
GCGGTTGGATGCACACAGGGAGCTATCGGACATTGGGAATCTGGTCGTCGCTTCCCAGAC
CTTAAAACATGCCGTGCTCTTGTTGCGTGCCTAAACAAGTTAGGCGCAAAAGTCAGTCTT
GATGACGTGTTCCCGCCGGAACACAAAGCCGCTTAA
ATGAGCAACCTACGAAAATATCGAGAGTCACTGAATATCTCTCAAACAACACTTGCTAAG
GCGGTTGGATGCACACAGGGAGCTATCGGACATTGGGAATCTGGTCGTCGCTTCCCAGAC
CTTAAAACATGCCGTGCTCTTGTTGCGTGCCTAAACAAGTTAGGCGCAAAAGTCAGTCTT
GATGACGTGTTCCCGCCGGAACACAAAGCCGCTTAA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| AT325 | Streptococcus pneumoniae TIGR4 |
34.783 |
71.134 |
0.333 |
| AT303 | Pseudomonas putida KT2440 |
32 |
52.632 |
0.222 |
| AT1067 | Haemophilus influenzae Rd KW20 |
37.736 |
54.082 |
0.278 |
| AT182 | Pseudomonas aeruginosa PAO1 |
40.625 |
17.391 |
0.181 |
| AT6088 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
27.778 |
42.857 |
0.139 |
| AT174 | Vibrio cholerae O1 biovar El Tor str. N16961 |
30.303 |
31.731 |
0.139 |
| AT6025 | Pseudomonas sp. LM13 |
29.31 |
52.252 |
0.236 |