TAfinder detailed results

Overview


Job ID 9mizKMmBqU
Sequence name Escherichia coli strain DH5alpha chromosome, complete genome.
Predicted type II

Orphan Antitoxin (Protein)


Predicted family EcnA (AT10118) Predicted domain -
Locus tag C1467_RS22520 Length 48 a.a.
Coordinates 4342309..4342455 (-)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C1467_RS22465 4338492..4339226 + 735 WP_000829498.1 fumarate reductase iron-sulfur protein -
C1467_RS22470 4339237..4339632 + 396 WP_000208757.1 fumarate reductase subunit FrdC -
C1467_RS22475 4339643..4340002 + 360 WP_001299198.1 fumarate reductase subunit FrdD -
C1467_RS22480 4340065..4341198 + 1134 WP_001349957.1 BlaEC family class C beta-lactamase -
C1467_RS22485 4341287..4341820 + 534 WP_001238378.1 lipocalin Blc -
C1467_RS22490 4341817..4342134 - 318 WP_000118482.1 quaternary ammonium compound efflux SMR transporter SugE -
C1467_RS22495 4342309..4342455 - 147 WP_000239596.1 lipoprotein toxin entericidin B Antitoxin
C1467_RS22500 4342566..4342691 - 126 WP_000977757.1 lipoprotein antitoxin entericidin A -
C1467_RS22505 4342743..4343309 - 567 WP_000257278.1 elongation factor P -
C1467_RS22510 4343351..4344379 + 1029 WP_000940530.1 EF-P beta-lysylation protein EpmB -
C1467_RS22515 4344769..4345638 + 870 WP_001008047.1 YjeJ family protein -
C1467_RS22520 4345688..4346041 - 354 WP_000558209.1 DUF4156 domain-containing protein -

Domains


The domains were predicted by HMMER and were sorted by score.

Orphan Antitoxin


No domain identified.



Sequences


Orphan Antitoxin        


Download         Length:         Molecular weight: 4809.53 Da        Isoelectric Point: 7.9947

>WP_000239596.1 Orphan_TA_102 Antitoxin
MVKKTIAAIFSVLVLSTVLTACNTTRGVGEDISDGGNAISGAATKAQQ*

Download         Length: 147 bp

>WP_000239596.1 Orphan_TA_102 Antitoxin
TTATTGCTGCGCTTTCGTTGCTGCACCAGAAATCGCGTTACCGCCATCAGAAATGTCTTC
ACCAACGCCACGCGTGGTGTTGCAGGCAGTTAATACTGTTGAAAGCACCAGAACAGAAAA
GATCGCTGCAATTGTCTTCTTCACCAT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
AT10118 Xanthomonas axonopodis pv. citri str. 306

31.818

88

0.286