TAfinder detailed results
Overview
| Job ID | 9mizKMmBqU | ||
| Sequence name | Escherichia coli strain DH5alpha chromosome, complete genome. | ||
| Predicted type | I | ||
Orphan Toxin (Protein)
| Predicted family | hokX (T10211) | Predicted domain | - |
| Locus tag | C1467_RS17915 | Length | 50 a.a. |
| Coordinates | 3422312..3422464 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C1467_RS17850 | 3417489..3417707 | - | 219 | WP_000885781.1 | enterobactin biosynthesis protein YbdZ | - |
| C1467_RS17855 | 3417710..3418912 | - | 1203 | WP_000125810.1 | enterochelin esterase | - |
| C1467_RS17865 | 3419155..3421395 | + | 2241 | WP_001034879.1 | siderophore enterobactin receptor FepA | - |
| C1467_RS25590 | 3421435..3421533 | + | 99 | Protein_3293 | hypothetical protein | - |
| C1467_RS17870 | 3421570..3422190 | + | 621 | WP_001298903.1 | enterobactin synthase subunit EntD | - |
| C1467_RS17875 | 3422312..3422464 | - | 153 | WP_000956465.1 | type I toxin-antitoxin system toxin HokE | Toxin |
| C1467_RS17880 | 3422815..3422967 | - | 153 | WP_000956456.1 | type I toxin-antitoxin system toxin HokE | - |
| C1467_RS17895 | 3423409..3424527 | + | 1119 | WP_001130619.1 | YbdK family carboxylate-amine ligase | - |
| C1467_RS17900 | 3424593..3424841 | + | 249 | WP_000682518.1 | DUF1158 domain-containing protein | - |
| C1467_RS17905 | 3424906..3425274 | + | 369 | WP_000360951.1 | MmcQ/YjbR family DNA-binding protein | - |
| C1467_RS17910 | 3425368..3426021 | + | 654 | WP_000351464.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
| C1467_RS17915 | 3426129..3427376 | + | 1248 | WP_001153143.1 | mechanosensitive ion channel YbdG | - |
Domains
The domains were predicted by HMMER and were sorted by score.
Orphan Toxin
No domain identified.
Sequences
Orphan Toxin
Download Length: Molecular weight: 5591.80 Da Isoelectric Point: 7.7891
>WP_000956465.1 Orphan_TA_80 Toxin
MLTKYALVAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK*
MLTKYALVAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK*
Download Length: 153 bp
>WP_000956465.1 Orphan_TA_80 Toxin
CTACTTCTTCGGTTCGTAAGCGAGAACAGCCTTAAACTCAATATTACGTTCCTTTACGGT
GAACTCACACAGCGAGTCTCCGACCAGAAGCGTAAATCCCAGTACCGTCAAACACAGCAC
TATGACTGCCACAAGGGCATATTTCGTCAGCAT
CTACTTCTTCGGTTCGTAAGCGAGAACAGCCTTAAACTCAATATTACGTTCCTTTACGGT
GAACTCACACAGCGAGTCTCCGACCAGAAGCGTAAATCCCAGTACCGTCAAACACAGCAC
TATGACTGCCACAAGGGCATATTTCGTCAGCAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| T10211 | E.coli NADPH-sulfite reductase flavoprotein component (cysJ) NADPH-sulfite reductase hemoprotein component (cysI) and 3' |
58 |
100 |
0.569 |
| T6369 | Escherichia coli K-12 |
40.816 |
100 |
0.392 |
| T10208 | Escherichia coli C |
46.667 |
90 |
0.412 |
| T10210 | Hafnia alvei |
44 |
96.154 |
0.431 |
| T6370 | Escherichia coli |
43.182 |
88 |
0.373 |
| T6324 | Escherichia coli |
43.902 |
78.846 |
0.353 |
| T6363 | uncultured bacterium |
43.902 |
78.846 |
0.353 |
| T10039 | Escherichia coli O157:H7 str. Sakai |
36.17 |
92.157 |
0.333 |
| T10209 | Escherichia coli strain ECOR24 |
32.609 |
92 |
0.294 |
| T10124 | Erwinia amylovora ATCC 49946 |
45.161 |
96.875 |
0.275 |