Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   SPYH293_RS00665 Genome accession   NZ_HG316453
Coordinates   104464..104748 (+) Length   94 a.a.
NCBI ID   WP_011284422.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain H293     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 99464..109748
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SPYH293_RS00640 (SPYH293_00134) - 101410..101775 (+) 366 WP_002986560.1 DUF1033 family protein -
  SPYH293_RS00645 (SPYH293_00135) comGA 101868..102806 (+) 939 WP_020904831.1 competence type IV pilus ATPase ComGA Machinery gene
  SPYH293_RS00650 (SPYH293_00136) comGB 102742..103776 (+) 1035 WP_226316548.1 competence type IV pilus assembly protein ComGB Machinery gene
  SPYH293_RS00655 (SPYH293_00137) comGC 103778..104104 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  SPYH293_RS00660 (SPYH293_00138) comGD 104079..104507 (+) 429 WP_002986548.1 competence type IV pilus minor pilin ComGD Machinery gene
  SPYH293_RS00665 (SPYH293_00139) comGE 104464..104748 (+) 285 WP_011284422.1 competence type IV pilus minor pilin ComGE Machinery gene
  SPYH293_RS00670 (SPYH293_00140) comGF 104741..105175 (+) 435 WP_020904833.1 competence type IV pilus minor pilin ComGF Machinery gene
  SPYH293_RS00675 (SPYH293_00141) comGG 105159..105485 (+) 327 WP_002986539.1 competence type IV pilus minor pilin ComGG -
  SPYH293_RS00680 (SPYH293_00142) comGH 105583..106536 (+) 954 WP_010921802.1 class I SAM-dependent methyltransferase Machinery gene
  SPYH293_RS00685 (SPYH293_00143) - 106595..107791 (+) 1197 WP_020904834.1 acetate kinase -
  SPYH293_RS08320 - 107978..108286 (+) 309 Protein_89 hypothetical protein -
  SPYH293_RS00690 (SPYH293_00144) proC 108369..109139 (-) 771 WP_002986527.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10654.59 Da        Isoelectric Point: 8.9043

>NTDB_id=989656 SPYH293_RS00665 WP_011284422.1 104464..104748(+) (comGE) [Streptococcus pyogenes strain H293]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEITLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=989656 SPYH293_RS00665 WP_011284422.1 104464..104748(+) (comGE) [Streptococcus pyogenes strain H293]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATTGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATAACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383