Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   V3C22_RS02105 Genome accession   NZ_CP183775
Coordinates   427541..427771 (+) Length   76 a.a.
NCBI ID   WP_002275977.1    Uniprot ID   Q8DVP7
Organism   Streptococcus mutans strain Xc     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context


Location: 422541..432771
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V3C22_RS02080 (V3C22_02080) rnpM 423116..423412 (+) 297 WP_002263922.1 RNase P modulator RnpM -
  V3C22_RS02085 (V3C22_02085) - 423405..423707 (+) 303 WP_002262601.1 YlxQ-related RNA-binding protein -
  V3C22_RS02090 (V3C22_02090) - 423728..423934 (+) 207 Protein_374 translation initiation factor IF-2 N-terminal domain-containing protein -
  V3C22_RS02095 (V3C22_02095) infB 424256..426478 (+) 2223 Protein_375 translation initiation factor IF-2 -
  V3C22_RS02100 (V3C22_02100) rbfA 426712..427062 (+) 351 WP_002262599.1 30S ribosome-binding factor RbfA -
  V3C22_RS02105 (V3C22_02105) cipB 427541..427771 (+) 231 WP_002275977.1 bacteriocin class II family protein Regulator
  V3C22_RS02110 (V3C22_02110) - 428162..428605 (+) 444 WP_226706655.1 CopY/TcrY family copper transport repressor -
  V3C22_RS02115 (V3C22_02115) - 428602..430830 (+) 2229 WP_226706656.1 heavy metal translocating P-type ATPase -
  V3C22_RS02120 (V3C22_02120) copZ 430843..431046 (+) 204 WP_002263706.1 copper chaperone CopZ -
  V3C22_RS02125 (V3C22_02125) - 431292..432113 (+) 822 WP_419744543.1 Cof-type HAD-IIB family hydrolase -
  V3C22_RS02130 (V3C22_02130) - 432219..432740 (-) 522 WP_002307690.1 YgjV family protein -

Sequence


Protein


Download         Length: 76 a.a.        Molecular weight: 7229.19 Da        Isoelectric Point: 3.7781

>NTDB_id=983229 V3C22_RS02105 WP_002275977.1 427541..427771(+) (cipB) [Streptococcus mutans strain Xc]
MNTQAFEQFNVMDNEALSTVEGGGMIRCALGTAGSAGLGFVGGMGAGTVTLPVVGTVSGAALGGWSGAAVGAATFC

Nucleotide


Download         Length: 231 bp        

>NTDB_id=983229 V3C22_RS02105 WP_002275977.1 427541..427771(+) (cipB) [Streptococcus mutans strain Xc]
ATGAATACACAAGCATTTGAACAATTTAACGTAATGGATAATGAAGCACTTTCAACTGTTGAGGGTGGTGGTATGATTAG
ATGTGCACTTGGCACAGCTGGTTCTGCAGGTTTAGGATTTGTAGGGGGTATGGGAGCTGGTACAGTTACTCTCCCAGTCG
TTGGTACAGTATCTGGAGCGGCTTTAGGAGGCTGGTCTGGAGCAGCTGTAGGTGCTGCTACTTTTTGTTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q8DVP7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

71.429

55.263

0.395


Multiple sequence alignment