Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | WOC63_RS11900 | Genome accession | NZ_CP150765 |
| Coordinates | 2396225..2396695 (-) | Length | 156 a.a. |
| NCBI ID | WP_000934760.1 | Uniprot ID | A0AAN2D761 |
| Organism | Staphylococcus aureus strain TUM20963 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2366477..2425228 | 2396225..2396695 | within | 0 |
Gene organization within MGE regions
Location: 2366477..2425228
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WOC63_RS11690 (WOC63_11685) | scn | 2366477..2366827 (-) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| WOC63_RS11695 (WOC63_11690) | - | 2367338..2367676 (-) | 339 | Protein_2270 | SH3 domain-containing protein | - |
| WOC63_RS11700 (WOC63_11695) | sak | 2368325..2368816 (-) | 492 | WP_000920038.1 | staphylokinase | - |
| WOC63_RS11705 (WOC63_11700) | - | 2369007..2369762 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| WOC63_RS11710 (WOC63_11705) | - | 2369774..2370028 (-) | 255 | WP_000611512.1 | phage holin | - |
| WOC63_RS11715 (WOC63_11710) | - | 2370080..2370187 (+) | 108 | WP_031762631.1 | hypothetical protein | - |
| WOC63_RS11720 (WOC63_11715) | pepG1 | 2370240..2370374 (-) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| WOC63_RS11725 (WOC63_11720) | sep | 2370619..2371401 (-) | 783 | WP_000034846.1 | staphylococcal enterotoxin type P | - |
| WOC63_RS11730 (WOC63_11725) | - | 2371813..2372187 (-) | 375 | WP_000340977.1 | hypothetical protein | - |
| WOC63_RS11735 (WOC63_11730) | - | 2372243..2372530 (-) | 288 | WP_001040255.1 | hypothetical protein | - |
| WOC63_RS11740 (WOC63_11735) | - | 2372577..2372729 (-) | 153 | WP_000654329.1 | hypothetical protein | - |
| WOC63_RS11745 (WOC63_11740) | - | 2372719..2376504 (-) | 3786 | WP_000582184.1 | phage tail spike protein | - |
| WOC63_RS11750 (WOC63_11745) | - | 2376520..2378004 (-) | 1485 | WP_000567393.1 | phage distal tail protein | - |
| WOC63_RS11755 (WOC63_11750) | - | 2378001..2382545 (-) | 4545 | WP_000504557.1 | phage tail tape measure protein | - |
| WOC63_RS11760 (WOC63_11755) | gpGT | 2382602..2382739 (-) | 138 | WP_368409776.1 | phage tail assembly chaperone GT | - |
| WOC63_RS11765 (WOC63_11760) | gpG | 2382790..2383140 (-) | 351 | WP_001096355.1 | phage tail assembly chaperone G | - |
| WOC63_RS11770 (WOC63_11765) | - | 2383190..2383414 (-) | 225 | WP_071621395.1 | Ig-like domain-containing protein | - |
| WOC63_RS11775 (WOC63_11770) | - | 2383456..2384100 (-) | 645 | WP_000268735.1 | major tail protein | - |
| WOC63_RS11780 (WOC63_11775) | - | 2384101..2384508 (-) | 408 | WP_000565498.1 | hypothetical protein | - |
| WOC63_RS11785 (WOC63_11780) | - | 2384505..2384909 (-) | 405 | WP_000114226.1 | HK97 gp10 family phage protein | - |
| WOC63_RS11790 (WOC63_11785) | - | 2384906..2385268 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| WOC63_RS11795 (WOC63_11790) | - | 2385252..2385536 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| WOC63_RS11800 (WOC63_11795) | - | 2385526..2385810 (-) | 285 | WP_000238236.1 | hypothetical protein | - |
| WOC63_RS11805 (WOC63_11800) | - | 2385830..2386975 (-) | 1146 | WP_000154559.1 | phage major capsid protein | - |
| WOC63_RS11810 (WOC63_11805) | - | 2386999..2387736 (-) | 738 | WP_000642727.1 | head maturation protease, ClpP-related | - |
| WOC63_RS11815 (WOC63_11810) | - | 2387720..2388907 (-) | 1188 | WP_000025274.1 | phage portal protein | - |
| WOC63_RS11820 (WOC63_11815) | - | 2388923..2390585 (-) | 1663 | Protein_2295 | terminase large subunit domain-containing protein | - |
| WOC63_RS11825 (WOC63_11820) | - | 2390582..2390926 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| WOC63_RS11830 (WOC63_11825) | - | 2391056..2391355 (-) | 300 | WP_000988336.1 | HNH endonuclease | - |
| WOC63_RS11835 (WOC63_11830) | - | 2391587..2392003 (-) | 417 | WP_000590122.1 | hypothetical protein | - |
| WOC63_RS11840 (WOC63_11835) | - | 2392031..2392231 (-) | 201 | WP_000265043.1 | DUF1514 family protein | - |
| WOC63_RS11845 (WOC63_11840) | rinB | 2392231..2392380 (-) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| WOC63_RS11850 (WOC63_11845) | - | 2392377..2392763 (-) | 387 | WP_000592207.1 | hypothetical protein | - |
| WOC63_RS11855 (WOC63_11850) | - | 2392760..2392966 (-) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| WOC63_RS11860 (WOC63_11855) | - | 2392963..2393208 (-) | 246 | WP_001282074.1 | hypothetical protein | - |
| WOC63_RS11865 (WOC63_11860) | - | 2393245..2393781 (-) | 537 | WP_001066447.1 | dUTP diphosphatase | - |
| WOC63_RS11870 (WOC63_11865) | - | 2393774..2394022 (-) | 249 | WP_001065094.1 | DUF1024 family protein | - |
| WOC63_RS11875 (WOC63_11870) | - | 2394037..2394279 (-) | 243 | WP_000131370.1 | SAV1978 family virulence-associated passenger protein | - |
| WOC63_RS11880 (WOC63_11875) | - | 2394283..2394651 (-) | 369 | WP_000101288.1 | SA1788 family PVL leukocidin-associated protein | - |
| WOC63_RS11885 (WOC63_11880) | - | 2394664..2395068 (-) | 405 | WP_000401960.1 | RusA family crossover junction endodeoxyribonuclease | - |
| WOC63_RS11890 (WOC63_11885) | - | 2395077..2395295 (-) | 219 | WP_000338530.1 | hypothetical protein | - |
| WOC63_RS11895 (WOC63_11890) | - | 2395302..2396195 (-) | 894 | WP_000148321.1 | DnaD domain-containing protein | - |
| WOC63_RS11900 (WOC63_11895) | ssbA | 2396225..2396695 (-) | 471 | WP_000934760.1 | single-stranded DNA-binding protein | Machinery gene |
| WOC63_RS11905 (WOC63_11900) | - | 2396696..2397313 (-) | 618 | WP_071665632.1 | MBL fold metallo-hydrolase | - |
| WOC63_RS11910 (WOC63_11905) | - | 2397394..2398314 (-) | 921 | WP_000138475.1 | recombinase RecT | - |
| WOC63_RS11915 (WOC63_11910) | - | 2398316..2400259 (-) | 1944 | WP_000700555.1 | AAA family ATPase | - |
| WOC63_RS11920 (WOC63_11915) | - | 2400268..2400531 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| WOC63_RS11925 (WOC63_11920) | - | 2400540..2400800 (-) | 261 | WP_000291510.1 | DUF1108 family protein | - |
| WOC63_RS11930 (WOC63_11925) | - | 2400805..2401107 (-) | 303 | WP_000165371.1 | DUF2482 family protein | - |
| WOC63_RS11935 (WOC63_11930) | - | 2401202..2401363 (-) | 162 | WP_000048129.1 | DUF1270 family protein | - |
| WOC63_RS11940 (WOC63_11935) | - | 2401360..2401683 (-) | 324 | WP_001120201.1 | DUF771 domain-containing protein | - |
| WOC63_RS11945 (WOC63_11940) | - | 2401738..2402118 (+) | 381 | WP_000762521.1 | DUF2513 domain-containing protein | - |
| WOC63_RS11950 (WOC63_11945) | - | 2402105..2402302 (-) | 198 | WP_001148862.1 | hypothetical protein | - |
| WOC63_RS11955 (WOC63_11950) | - | 2402318..2403070 (-) | 753 | WP_001148605.1 | phage antirepressor KilAC domain-containing protein | - |
| WOC63_RS11960 (WOC63_11955) | - | 2403121..2403450 (+) | 330 | WP_000128907.1 | hypothetical protein | - |
| WOC63_RS11965 (WOC63_11960) | - | 2403439..2403654 (-) | 216 | WP_001025404.1 | MW1434 family type I TA system toxin | - |
| WOC63_RS11970 (WOC63_11965) | - | 2403670..2403933 (-) | 264 | WP_000854072.1 | helix-turn-helix transcriptional regulator | - |
| WOC63_RS11975 (WOC63_11970) | - | 2403930..2404103 (-) | 174 | WP_001801500.1 | hypothetical protein | - |
| WOC63_RS11980 (WOC63_11975) | - | 2404066..2404779 (+) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| WOC63_RS11985 (WOC63_11980) | - | 2404795..2405727 (+) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| WOC63_RS11990 (WOC63_11985) | - | 2405733..2406074 (+) | 342 | WP_000591750.1 | hypothetical protein | - |
| WOC63_RS11995 (WOC63_11990) | - | 2406278..2406460 (+) | 183 | WP_000705248.1 | hypothetical protein | - |
| WOC63_RS12000 (WOC63_11995) | - | 2406560..2407024 (+) | 465 | WP_000825947.1 | hypothetical protein | - |
| WOC63_RS12005 (WOC63_12000) | - | 2407083..2408120 (+) | 1038 | WP_000857191.1 | site-specific integrase | - |
| WOC63_RS12010 (WOC63_12005) | sph | 2408177..2409001 (+) | 825 | Protein_2333 | sphingomyelin phosphodiesterase | - |
| WOC63_RS12015 (WOC63_12010) | lukG | 2409239..2410255 (-) | 1017 | WP_000595324.1 | bi-component leukocidin LukGH subunit G | - |
| WOC63_RS12020 (WOC63_12015) | lukH | 2410277..2411332 (-) | 1056 | WP_000791407.1 | bi-component leukocidin LukGH subunit H | - |
| WOC63_RS12025 (WOC63_12020) | - | 2411767..2412990 (+) | 1224 | WP_000206638.1 | ArgE/DapE family deacylase | - |
| WOC63_RS12030 (WOC63_12025) | - | 2413362..2414207 (-) | 846 | WP_000812008.1 | class I SAM-dependent methyltransferase | - |
| WOC63_RS12035 (WOC63_12030) | - | 2414269..2415180 (-) | 912 | WP_000825510.1 | iron-hydroxamate ABC transporter substrate-binding protein | - |
| WOC63_RS12040 (WOC63_12035) | - | 2415341..2416648 (+) | 1308 | WP_001045079.1 | TrkH family potassium uptake protein | - |
| WOC63_RS12045 (WOC63_12040) | - | 2417501..2417944 (-) | 444 | WP_000022887.1 | GNAT family N-acetyltransferase | - |
| WOC63_RS12050 (WOC63_12045) | - | 2418050..2418487 (-) | 438 | WP_011447041.1 | hypothetical protein | - |
| WOC63_RS12055 (WOC63_12050) | - | 2418805..2419395 (-) | 591 | WP_001293058.1 | terminase small subunit | - |
| WOC63_RS12060 (WOC63_12055) | - | 2419392..2419604 (-) | 213 | WP_000128898.1 | LuxR C-terminal-related transcriptional regulator | - |
| WOC63_RS12065 (WOC63_12060) | - | 2419665..2420211 (+) | 547 | Protein_2344 | site-specific integrase | - |
| WOC63_RS12070 (WOC63_12065) | groL | 2420306..2421922 (-) | 1617 | WP_000240645.1 | chaperonin GroEL | - |
| WOC63_RS12075 (WOC63_12070) | groES | 2421998..2422282 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
| WOC63_RS12080 (WOC63_12075) | mroQ | 2422457..2423200 (+) | 744 | WP_000197635.1 | CPBP family intramembrane glutamic endopeptidase MroQ | - |
| WOC63_RS12085 (WOC63_12080) | - | 2423224..2424405 (-) | 1182 | WP_000120303.1 | SdrH family protein | - |
| WOC63_RS12090 (WOC63_12085) | - | 2424602..2425228 (+) | 627 | WP_000522384.1 | nitroreductase family protein | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=972155 WOC63_RS11900 WP_000934760.1 2396225..2396695(-) (ssbA) [Staphylococcus aureus strain TUM20963]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=972155 WOC63_RS11900 WP_000934760.1 2396225..2396695(-) (ssbA) [Staphylococcus aureus strain TUM20963]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |
| ssb | Neisseria meningitidis MC58 |
32.948 |
100 |
0.365 |
| ssb | Neisseria gonorrhoeae MS11 |
32.948 |
100 |
0.365 |