Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   ACJVG6_RS09540 Genome accession   NZ_CP177180
Coordinates   2008806..2009036 (-) Length   76 a.a.
NCBI ID   WP_002887015.1    Uniprot ID   -
Organism   Streptococcus salivarius strain MRD-KRBY     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2003806..2014036
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACJVG6_RS09505 - 2004200..2004646 (-) 447 WP_037605837.1 hypothetical protein -
  ACJVG6_RS09510 - 2004720..2005376 (-) 657 WP_002887011.1 CPBP family intramembrane glutamic endopeptidase -
  ACJVG6_RS09515 - 2005388..2005585 (-) 198 WP_002885716.1 helix-turn-helix transcriptional regulator -
  ACJVG6_RS09520 - 2005836..2007029 (-) 1194 WP_002885831.1 acetate kinase -
  ACJVG6_RS09525 comGH 2007086..2008042 (-) 957 WP_002887012.1 class I SAM-dependent methyltransferase Machinery gene
  ACJVG6_RS09530 comGG 2008087..2008404 (-) 318 WP_002887013.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACJVG6_RS09535 comGF 2008382..2008819 (-) 438 WP_002887014.1 competence type IV pilus minor pilin ComGF Machinery gene
  ACJVG6_RS09540 comGE 2008806..2009036 (-) 231 WP_002887015.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACJVG6_RS09545 comGD 2009068..2009496 (-) 429 WP_254593949.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACJVG6_RS09550 comGC 2009456..2009770 (-) 315 WP_170314557.1 competence type IV pilus major pilin ComGC Machinery gene
  ACJVG6_RS09555 comGB 2009779..2010879 (-) 1101 WP_139053029.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACJVG6_RS09560 comGA/cglA/cilD 2010761..2011702 (-) 942 WP_002887018.1 competence type IV pilus ATPase ComGA Machinery gene
  ACJVG6_RS09565 - 2011781..2012143 (-) 363 WP_002887019.1 DUF1033 family protein -

Sequence


Protein


Download         Length: 76 a.a.        Molecular weight: 8399.78 Da        Isoelectric Point: 10.0924

>NTDB_id=969643 ACJVG6_RS09540 WP_002887015.1 2008806..2009036(-) (comGE) [Streptococcus salivarius strain MRD-KRBY]
MAVLVLVSGLILDQINTNRRLMARNLHQQEVLSVATMAVQTKQDQLTLNGITVTVKRSQQGIAVYESGKEIIHVSQ

Nucleotide


Download         Length: 231 bp        

>NTDB_id=969643 ACJVG6_RS09540 WP_002887015.1 2008806..2009036(-) (comGE) [Streptococcus salivarius strain MRD-KRBY]
ATGGCTGTCTTAGTACTCGTCAGTGGTCTTATCTTGGATCAGATCAATACCAATCGTAGGCTAATGGCTAGGAATCTCCA
CCAACAGGAGGTCTTGAGTGTGGCAACCATGGCAGTTCAGACCAAACAGGATCAGTTGACCTTAAATGGCATCACAGTGA
CGGTAAAACGTAGCCAGCAAGGTATCGCGGTTTATGAATCAGGAAAGGAGATTATTCATGTCTCTCAATAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Streptococcus mutans UA140

39.189

97.368

0.382

  comGE Streptococcus mutans UA159

39.189

97.368

0.382