Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | ACLIMA_RS17745 | Genome accession | NZ_CP177039 |
| Coordinates | 3338981..3339121 (-) | Length | 46 a.a. |
| NCBI ID | WP_003184860.1 | Uniprot ID | A0ABM6LMF9 |
| Organism | Bacillus licheniformis strain MPB04 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3333981..3344121
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACLIMA_RS17720 (ACLIMA_17720) | - | 3334253..3334642 (-) | 390 | WP_003184847.1 | hotdog fold thioesterase | - |
| ACLIMA_RS17725 (ACLIMA_17725) | comA | 3334659..3335297 (-) | 639 | WP_003184849.1 | response regulator transcription factor | Regulator |
| ACLIMA_RS17730 (ACLIMA_17730) | - | 3335384..3337704 (-) | 2321 | Protein_3440 | ATP-binding protein | - |
| ACLIMA_RS17735 (ACLIMA_17735) | comX | 3337744..3337908 (-) | 165 | WP_011198251.1 | competence pheromone ComX | - |
| ACLIMA_RS17740 (ACLIMA_17740) | comQ | 3337923..3338792 (-) | 870 | WP_011198252.1 | polyprenyl synthetase family protein | Regulator |
| ACLIMA_RS17745 (ACLIMA_17745) | degQ | 3338981..3339121 (-) | 141 | WP_003184860.1 | degradation enzyme regulation protein DegQ | Regulator |
| ACLIMA_RS17750 (ACLIMA_17750) | - | 3339607..3339954 (+) | 348 | WP_009329512.1 | hypothetical protein | - |
| ACLIMA_RS17755 (ACLIMA_17755) | - | 3339997..3341217 (-) | 1221 | WP_003184864.1 | EAL and HDOD domain-containing protein | - |
| ACLIMA_RS17760 (ACLIMA_17760) | - | 3341396..3342865 (-) | 1470 | WP_003184866.1 | nicotinate phosphoribosyltransferase | - |
| ACLIMA_RS17765 (ACLIMA_17765) | - | 3342883..3343434 (-) | 552 | WP_003184868.1 | cysteine hydrolase family protein | - |
| ACLIMA_RS17770 (ACLIMA_17770) | - | 3343619..3344020 (-) | 402 | WP_003184870.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5747.56 Da Isoelectric Point: 8.4596
>NTDB_id=969246 ACLIMA_RS17745 WP_003184860.1 3338981..3339121(-) (degQ) [Bacillus licheniformis strain MPB04]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS
Nucleotide
Download Length: 141 bp
>NTDB_id=969246 ACLIMA_RS17745 WP_003184860.1 3338981..3339121(-) (degQ) [Bacillus licheniformis strain MPB04]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
71.429 |
91.304 |
0.652 |