Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | ACK2V1_RS06220 | Genome accession | NZ_CP176715 |
| Coordinates | 1199603..1199914 (+) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | A0A0H2XGS7 |
| Organism | Staphylococcus aureus strain GTVSS-007 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1194603..1204914
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACK2V1_RS06190 (ACK2V1_06190) | - | 1195386..1195589 (+) | 204 | WP_000087561.1 | YqgQ family protein | - |
| ACK2V1_RS06195 (ACK2V1_06195) | - | 1195586..1196572 (+) | 987 | WP_000161311.1 | ROK family glucokinase | - |
| ACK2V1_RS06200 (ACK2V1_06200) | - | 1196572..1196901 (+) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| ACK2V1_RS06205 (ACK2V1_06205) | - | 1196898..1197521 (+) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| ACK2V1_RS06210 (ACK2V1_06210) | comGA | 1197573..1198547 (+) | 975 | WP_000697220.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| ACK2V1_RS06215 (ACK2V1_06215) | comGB | 1198519..1199589 (+) | 1071 | WP_000776422.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| ACK2V1_RS06220 (ACK2V1_06220) | comGC | 1199603..1199914 (+) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| ACK2V1_RS06225 (ACK2V1_06225) | comGD | 1199892..1200338 (+) | 447 | WP_001788899.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| ACK2V1_RS06230 (ACK2V1_06230) | comGE | 1200325..1200624 (+) | 300 | WP_000844410.1 | hypothetical protein | Machinery gene |
| ACK2V1_RS06235 (ACK2V1_06235) | comGF | 1200542..1201039 (+) | 498 | WP_001788897.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| ACK2V1_RS06240 (ACK2V1_06240) | - | 1201136..1201282 (+) | 147 | WP_001792109.1 | hypothetical protein | - |
| ACK2V1_RS06245 (ACK2V1_06245) | - | 1201272..1201796 (+) | 525 | WP_001015120.1 | shikimate kinase | - |
| ACK2V1_RS06250 (ACK2V1_06250) | gcvT | 1201955..1203046 (+) | 1092 | WP_099130551.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ACK2V1_RS06255 (ACK2V1_06255) | gcvPA | 1203066..1204412 (+) | 1347 | WP_000019691.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=968620 ACK2V1_RS06220 WP_000472256.1 1199603..1199914(+) (comGC) [Staphylococcus aureus strain GTVSS-007]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=968620 ACK2V1_RS06220 WP_000472256.1 1199603..1199914(+) (comGC) [Staphylococcus aureus strain GTVSS-007]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comGC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comGC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |