NTDB

Overview

Name	Cj0011c	Type	Machinery gene
Locus tag	WHP83_RS02030	Genome accession	NZ_CP148154
Coordinates	384449..384688 (+)	Length	79 a.a.
NCBI ID	WP_002855574.1	Uniprot ID	A0AA44KFG0
Organism	Campylobacter jejuni strain Z1323HCJ0086
Function	DNA binding (predicted from homology) DNA binding and uptake

Genomic Context

Location: 379449..389688

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
WHP83_RS02010 (WHP83_02010)	-	380175..381401 (+)	1227	WP_002855588.1	HD domain-containing protein	-
WHP83_RS02015 (WHP83_02015)	-	381493..381889 (+)	397	Protein_390	DUF1440 domain-containing protein	-
WHP83_RS02020 (WHP83_02020)	ilvD	381901..383577 (-)	1677	WP_002898835.1	dihydroxy-acid dehydratase	-
WHP83_RS02025 (WHP83_02025)	rrc	383737..384384 (+)	648	WP_002855562.1	ferritin family protein	-
WHP83_RS02030 (WHP83_02030)	Cj0011c	384449..384688 (+)	240	WP_002855574.1	ComEA family DNA-binding protein	Machinery gene
WHP83_RS02035 (WHP83_02035)	rnhB	384722..385297 (+)	576	WP_002901745.1	ribonuclease HII	-
WHP83_RS02040 (WHP83_02040)	gltD	385298..386743 (-)	1446	WP_002901747.1	glutamate synthase subunit beta	-

Sequence

Protein

Download Length: 79 a.a. Molecular weight: 8838.48 Da Isoelectric Point: 10.1677

                                >NTDB_id=951836 WHP83_RS02030 WP_002855574.1 384449..384688(+) (Cj0011c) [Campylobacter jejuni strain Z1323HCJ0086]

MKKLLFLFFALTAFLFGAVNINTATLKELKSLNGIGEAKAKAILEYRKEANFTSIDDLKKVKGIGDKLFEKIKNDITVE

Nucleotide

Download Length: 240 bp

                                >NTDB_id=951836 WHP83_RS02030 WP_002855574.1 384449..384688(+) (Cj0011c) [Campylobacter jejuni strain Z1323HCJ0086]

ATGAAAAAATTACTATTTTTATTTTTTGCTTTAACGGCTTTTCTCTTTGGTGCTGTAAATATCAACACTGCAACGCTAAA

AGAATTAAAAAGTTTAAATGGTATTGGCGAAGCTAAGGCTAAAGCGATTTTAGAATACCGTAAAGAAGCAAATTTTACAA

GTATTGATGATCTTAAAAAAGTTAAAGGCATAGGTGATAAGCTTTTTGAAAAAATCAAAAATGATATCACAGTAGAATAA

Domains

Predicted by InterproScan.

Helix-hairpin-helix motif (HHH_3)

(18-77)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
Cj0011c	Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819	98.734	100	0.987
comE	Neisseria gonorrhoeae MS11	53.086	100	0.544
comE	Neisseria gonorrhoeae MS11	53.086	100	0.544
comE	Neisseria gonorrhoeae MS11	53.086	100	0.544
comE	Neisseria gonorrhoeae MS11	53.086	100	0.544
comEA	Bacillus subtilis subsp. subtilis str. 168	59.016	77.215	0.456
comEA	Acinetobacter baylyi ADP1	55.738	77.215	0.43
comEA	Staphylococcus aureus MW2	55.738	77.215	0.43
comEA	Staphylococcus aureus N315	55.738	77.215	0.43
comEA/celA/cilE	Streptococcus pneumoniae R6	50.794	79.747	0.405
comEA/celA/cilE	Streptococcus mitis NCTC 12261	50.794	79.747	0.405
comEA/celA/cilE	Streptococcus pneumoniae TIGR4	50.794	79.747	0.405
comEA/celA/cilE	Streptococcus pneumoniae Rx1	50.794	79.747	0.405
comEA/celA/cilE	Streptococcus pneumoniae D39	50.794	79.747	0.405
comEA	Lactococcus lactis subsp. cremoris KW2	51.613	78.481	0.405
comEA	Vibrio cholerae C6706	62.745	64.557	0.405
comEA	Vibrio cholerae strain A1552	62.745	64.557	0.405
comEA/celA/cilE	Streptococcus mitis SK321	49.206	79.747	0.392
comEA/comE1	Glaesserella parasuis strain SC1401	47.619	79.747	0.38
comEA	Acinetobacter baumannii D1279779	47.619	79.747	0.38
comE1/comEA	Haemophilus influenzae Rd KW20	50.847	74.684	0.38
comEA	Acinetobacter baumannii strain A118	46.032	79.747	0.367
comEA	Vibrio campbellii strain DS40M4	48.333	75.949	0.367

Detailed information NTG0951836