Detailed information NTG0948786

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: ACG3JM_RS09300
• Genome accession: NZ_CP171735
• Coordinates: 1823292..1823612 (+)
• Length: 106 a.a.
• NCBI ID: WP_013794397.1
• Uniprot ID: -
• Organism: Streptococcus parauberis strain DB-M11
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1818292..1828612

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACG3JM_RS09275 (ACG3JM_09275)	-	1818998..1820854 (+)	1857	WP_013794401.1	DUF859 family phage minor structural protein	-
ACG3JM_RS09280 (ACG3JM_09280)	-	1820903..1821241 (+)	339	WP_013794400.1	DUF1366 domain-containing protein	-
ACG3JM_RS09285 (ACG3JM_09285)	-	1821304..1821453 (+)	150	WP_259966511.1	hypothetical protein	-
ACG3JM_RS09290 (ACG3JM_09290)	-	1821457..1821921 (+)	465	WP_013794399.1	phage holin family protein	-
ACG3JM_RS09295 (ACG3JM_09295)	-	1821914..1822639 (+)	726	WP_013794398.1	peptidoglycan amidohydrolase family protein	-
ACG3JM_RS09300 (ACG3JM_09300)	comGC	1823292..1823612 (+)	321	WP_013794397.1	competence type IV pilus major pilin ComGC	Machinery gene
ACG3JM_RS09305 (ACG3JM_09305)	comGD	1823602..1824009 (+)	408	WP_243619590.1	competence type IV pilus minor pilin ComGD	Machinery gene
ACG3JM_RS09310 (ACG3JM_09310)	comGE	1823981..1824280 (+)	300	WP_259966510.1	competence type IV pilus minor pilin ComGE	Machinery gene
ACG3JM_RS09315 (ACG3JM_09315)	comGF/cglF	1824258..1824695 (+)	438	WP_003102915.1	competence type IV pilus minor pilin ComGF	Machinery gene
ACG3JM_RS09320 (ACG3JM_09320)	comGG	1824673..1825170 (+)	498	WP_003108640.1	competence type IV pilus minor pilin ComGG	-
ACG3JM_RS09325 (ACG3JM_09325)	comGH	1825277..1826233 (+)	957	WP_003103712.1	class I SAM-dependent methyltransferase	Machinery gene
ACG3JM_RS09330 (ACG3JM_09330)	-	1826289..1827482 (+)	1194	WP_003108638.1	acetate kinase	-
ACG3JM_RS09335 (ACG3JM_09335)	-	1827593..1827805 (+)	213	WP_003108636.1	helix-turn-helix transcriptional regulator	-
ACG3JM_RS09340 (ACG3JM_09340)	-	1827798..1828250 (+)	453	WP_003108634.1	hypothetical protein	-

Sequence

Protein

• Length: 106 a.a.
• Molecular weight: 11963.03 Da
• Isoelectric Point: 6.9754

>NTDB_id=948786 ACG3JM_RS09300 WP_013794397.1 1823292..1823612(+) (comGC) [Streptococcus parauberis strain DB-M11]
MSEITDTKYISVLCTFIEMLMVILIISILMLLFIPNLNKQKEKVLDTGGEALVKIVENQAELYALNNAGKVPSLNDLKSN
GNLTEKQITAYNDYYKKHSDKIPNVK

Nucleotide

• Length: 321 bp

>NTDB_id=948786 ACG3JM_RS09300 WP_013794397.1 1823292..1823612(+) (comGC) [Streptococcus parauberis strain DB-M11]
ATGTCTGAAATAACAGACACTAAATATATAAGTGTTTTATGTACATTTATTGAGATGCTAATGGTTATTCTTATTATTTC
TATACTGATGCTCTTATTTATTCCAAATTTAAACAAACAAAAAGAAAAAGTCTTGGATACCGGAGGAGAGGCTCTAGTTA
AAATAGTTGAAAATCAAGCTGAACTCTATGCATTGAACAATGCTGGCAAAGTGCCATCATTAAATGATTTAAAGAGCAAT
GGAAATTTAACAGAAAAGCAAATAACCGCTTATAATGATTATTATAAAAAACACAGTGATAAAATCCCAAATGTTAAATA
A

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Streptococcus mutans UA140	55.556	93.396	0.519
comGC	Streptococcus mutans UA159	55.556	93.396	0.519
comGC	Streptococcus gordonii str. Challis substr. CH1	53.846	85.849	0.462
comGC/cglC	Streptococcus mitis SK321	55.294	80.189	0.443
comGC	Lactococcus lactis subsp. cremoris KW2	52.222	84.906	0.443
comGC/cglC	Streptococcus pneumoniae D39	52.941	80.189	0.425
comGC/cglC	Streptococcus pneumoniae R6	52.941	80.189	0.425
comGC/cglC	Streptococcus pneumoniae Rx1	52.941	80.189	0.425
comGC/cglC	Streptococcus pneumoniae TIGR4	52.941	80.189	0.425
comGC/cglC	Streptococcus mitis NCTC 12261	53.571	79.245	0.425