Detailed information NTG0936669

Bioinformatically predicted

Overview

• Name: comE
• Type: Machinery gene
• Locus tag: V5F96_RS08590
• Genome accession: NZ_CP145059
• Coordinates: 1634406..1634801 (-)
• Length: 131 a.a.
• NCBI ID: WP_003703428.1
• Uniprot ID: -
• Organism: Neisseria gonorrhoeae strain WHO_W_2024
• Function: DNA binding (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	1627313..1641598	1634406..1634801	within	0

Gene organization within MGE regions

Location: 1627313..1641598

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
V5F96_RS08530 (V5F96_08540)	-	1627313..1627591 (-)	279	WP_003691583.1	hypothetical protein	-
V5F96_RS08535 (V5F96_08545)	-	1627598..1627816 (-)	219	WP_003691584.1	major capsid protein	-
V5F96_RS08540 (V5F96_08550)	-	1627890..1628087 (-)	198	WP_003689600.1	hypothetical protein	-
V5F96_RS08545 (V5F96_08555)	-	1628092..1628382 (-)	291	WP_012503914.1	hypothetical protein	-
V5F96_RS08550 (V5F96_08560)	-	1628427..1629777 (-)	1351	Protein_1670	replication initiation factor domain-containing protein	-
V5F96_RS08555 (V5F96_08565)	-	1629916..1630338 (-)	423	WP_003691751.1	very short patch repair endonuclease	-
V5F96_RS08560 (V5F96_08570)	-	1630344..1630940 (-)	597	WP_012503916.1	TIGR02391 family protein	-
V5F96_RS08565 (V5F96_08575)	-	1631130..1631987 (-)	858	WP_012503917.1	ATP-binding protein	-
V5F96_RS08570 (V5F96_08580)	-	1632001..1632372 (-)	372	WP_012503918.1	DNA cytosine methyltransferase	-
V5F96_RS08575 (V5F96_08585)	-	1632369..1632977 (-)	609	WP_080229275.1	DNA cytosine methyltransferase	-
V5F96_RS08580 (V5F96_08590)	-	1633346..1633492 (+)	147	WP_003691757.1	hypothetical protein	-
V5F96_RS08585 (V5F96_08595)	comP	1633869..1634318 (-)	450	WP_002214937.1	type IV pilin protein	Machinery gene
V5F96_RS08590 (V5F96_08600)	comE	1634406..1634801 (-)	396	WP_003703428.1	helix-hairpin-helix domain-containing protein	Machinery gene
V5F96_RS08595 (V5F96_08605)	-	1634903..1635022 (-)	120	Protein_1679	competence protein ComE	-
V5F96_RS08625 (V5F96_08635)	-	1640647..1641300 (-)	654	Protein_1680	TIGR01621 family pseudouridine synthase	-
V5F96_RS08630 (V5F96_08640)	-	1641254..1641598 (-)	345	WP_003691787.1	HAD hydrolase family protein	-

Sequence

Protein

• Length: 131 a.a.
• Molecular weight: 13796.61 Da
• Isoelectric Point: 10.8790

>NTDB_id=936669 V5F96_RS08590 WP_003703428.1 1634406..1634801(-) (comE) [Neisseria gonorrhoeae strain WHO_W_2024]
MSRGGATPYRFLLIRHIVARCGLLFATLKGKTMKKMFVLFCMLFSCAFSLAAVNINAASQQELEALPGIGPAKAKAIAEY
RAQNGAFKSVDDLIKVKGIGPAVLAKLKDQASVGAPAPKGPAKPVLPAVKK

Nucleotide

• Length: 396 bp

>NTDB_id=936669 V5F96_RS08590 WP_003703428.1 1634406..1634801(-) (comE) [Neisseria gonorrhoeae strain WHO_W_2024]
TTGAGCCGGGGCGGGGCAACGCCGTACCGGTTTTTGTTAATCCGCCATATCGTCGCAAGATGCGGTTTGTTGTTTGCAAC
CCTTAAAGGAAAAACCATGAAAAAAATGTTTGTATTGTTCTGTATGCTGTTCTCCTGCGCCTTCTCCCTTGCGGCGGTAA
ACATCAATGCGGCTTCGCAGCAGGAGCTGGAGGCGCTGCCGGGCATAGGCCCGGCGAAGGCGAAGGCCATTGCGGAATAC
CGCGCGCAAAACGGCGCGTTCAAGTCTGTGGACGATTTGATCAAGGTGAAGGGCATCGGTCCGGCGGTGCTGGCGAAGCT
GAAAGACCAGGCTTCCGTCGGCGCGCCCGCACCAAAAGGCCCCGCCAAACCGGTGCTGCCTGCGGTTAAAAAATAG

Domains

Predicted by InterproScan.

• Helix-hairpin-helix motif (HHH_3) (52-110)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comE	Neisseria gonorrhoeae MS11	100	100	1
comE	Neisseria gonorrhoeae MS11	100	100	1
comE	Neisseria gonorrhoeae MS11	100	100	1
comE	Neisseria gonorrhoeae MS11	100	100	1