Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   ACD268_RS08325 Genome accession   NZ_CP168299
Coordinates   1632069..1632218 (-) Length   49 a.a.
NCBI ID   WP_001818346.1    Uniprot ID   Q9FBH1
Organism   Streptococcus pneumoniae strain FC1     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 1627069..1637218
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACD268_RS08290 (ACD268_08290) trmB 1627311..1627946 (-) 636 WP_001266083.1 tRNA (guanosine(46)-N7)-methyltransferase TrmB -
  ACD268_RS08295 (ACD268_08295) ccrZ 1627943..1628737 (-) 795 WP_000363002.1 cell cycle regulator CcrZ -
  ACD268_RS08300 (ACD268_08300) - 1628899..1629510 (-) 612 WP_050110772.1 CPBP family intramembrane glutamic endopeptidase -
  ACD268_RS08305 (ACD268_08305) blpZ 1629661..1629894 (-) 234 WP_000276498.1 immunity protein BlpZ -
  ACD268_RS08310 (ACD268_08310) - 1629936..1630625 (-) 690 WP_000760523.1 CPBP family intramembrane glutamic endopeptidase -
  ACD268_RS08315 (ACD268_08315) - 1630677..1631060 (-) 384 WP_000877381.1 hypothetical protein -
  ACD268_RS08320 (ACD268_08320) - 1631846..1631965 (-) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  ACD268_RS08325 (ACD268_08325) cipB 1632069..1632218 (-) 150 WP_001818346.1 bacteriocin-like peptide BlpO Regulator
  ACD268_RS08330 (ACD268_08330) blpN 1632462..1632665 (-) 204 WP_001099491.1 two-peptide bacteriocin subunit BlpN -
  ACD268_RS08335 (ACD268_08335) blpM 1632681..1632935 (-) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  ACD268_RS08340 (ACD268_08340) - 1633085..1633890 (-) 806 Protein_1651 IS5 family transposase -
  ACD268_RS08345 (ACD268_08345) - 1634093..1634497 (-) 405 WP_000846944.1 hypothetical protein -
  ACD268_RS08350 (ACD268_08350) - 1634494..1634658 (-) 165 WP_000727118.1 hypothetical protein -
  ACD268_RS08355 (ACD268_08355) - 1634955..1635074 (-) 120 WP_000346298.1 PncF family bacteriocin immunity protein -
  ACD268_RS08360 (ACD268_08360) blpU 1635077..1635307 (-) 231 WP_000379967.1 bacteriocin-like peptide BlpU -
  ACD268_RS08365 (ACD268_08365) blpJ 1635376..1635645 (-) 270 WP_044814960.1 bacteriocin-like peptide BlpJ -
  ACD268_RS08370 (ACD268_08370) blpI 1636112..1636309 (-) 198 WP_001093259.1 bacteriocin-like peptide BlpI -
  ACD268_RS08375 (ACD268_08375) comA/nlmT 1636591..1637178 (+) 588 WP_000205166.1 cysteine peptidase family C39 domain-containing protein Regulator

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5134.91 Da        Isoelectric Point: 3.9133

>NTDB_id=935447 ACD268_RS08325 WP_001818346.1 1632069..1632218(-) (cipB) [Streptococcus pneumoniae strain FC1]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=935447 ACD268_RS08325 WP_001818346.1 1632069..1632218(-) (cipB) [Streptococcus pneumoniae strain FC1]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q9FBH1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51