Detailed information NTG0920145

Bioinformatically predicted

Overview

• Name: phrF
• Type: Regulator
• Locus tag: VDS57_RS07775
• Genome accession: NZ_CP141839
• Coordinates: 1454326..1454445 (+)
• Length: 39 a.a.
• NCBI ID: WP_009968329.1
• Uniprot ID: A0A199WEM2
• Organism: Bacillus subtilis strain PN1236
• Function: antagonize RapF (predicted from homology) Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
IS/Tn	1455131..1456483	1454326..1454445	flank	686

Gene organization within MGE regions

Location: 1454326..1456483

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
VDS57_RS07775 (VDS57_07775)	phrF	1454326..1454445 (+)	120	WP_009968329.1	phosphatase RapF inhibitor PhrF	Regulator
VDS57_RS07780 (VDS57_07780)	-	1454543..1454970 (+)	428	Protein_1524	YbaK/EbsC family protein	-
VDS57_RS07785 (VDS57_07785)	-	1455131..1456483 (+)	1353	WP_014478984.1	IS1182 family transposase	-

Sequence

Protein

• Length: 39 a.a.
• Molecular weight: 4199.10 Da
• Isoelectric Point: 10.4997

>NTDB_id=920145 VDS57_RS07775 WP_009968329.1 1454326..1454445(+) (phrF) [Bacillus subtilis strain PN1236]
MKLKSKLLLSCLALSTVFVATTIANAPTHQIEVAQRGMI

Nucleotide

• Length: 120 bp

>NTDB_id=920145 VDS57_RS07775 WP_009968329.1 1454326..1454445(+) (phrF) [Bacillus subtilis strain PN1236]
ATGAAATTGAAGTCTAAACTATTACTCTCTTGTCTGGCTCTAAGCACTGTGTTCGTGGCAACAACTATTGCAAATGCACC
TACACACCAAATTGAAGTTGCACAACGAGGAATGATTTAA

Domains

Predicted by InterproScan.

• Rap-phr extracellular signalling (PhrC_PhrF) (3-39)

3D structure

• AlphaFold DB: A0A199WEM2

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
phrF	Bacillus subtilis subsp. subtilis str. 168	100	100	1
phrC	Bacillus subtilis subsp. subtilis str. 168	48.718	100	0.487