Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   ABQ274_RS10560 Genome accession   NZ_CP159281
Coordinates   2106969..2107253 (+) Length   94 a.a.
NCBI ID   WP_010906314.1    Uniprot ID   Q9CDU4
Organism   Lactococcus lactis strain FNZ339     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2101969..2112253
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABQ274_RS10515 (ABQ274_10515) - 2103013..2103243 (+) 231 WP_129300312.1 hypothetical protein -
  ABQ274_RS10520 (ABQ274_10520) - 2103256..2103606 (+) 351 WP_023164508.1 hypothetical protein -
  ABQ274_RS10525 (ABQ274_10525) - 2103619..2103906 (+) 288 WP_023164507.1 phage holin -
  ABQ274_RS10530 (ABQ274_10530) - 2103906..2104685 (+) 780 WP_353726892.1 peptidoglycan amidohydrolase family protein -
  ABQ274_RS10535 (ABQ274_10535) - 2104765..2105487 (+) 723 WP_353726893.1 hypothetical protein -
  ABQ274_RS10540 (ABQ274_10540) comGC 2105593..2105862 (+) 270 WP_023349160.1 competence type IV pilus major pilin ComGC Machinery gene
  ABQ274_RS10545 (ABQ274_10545) comGD 2105855..2106253 (+) 399 WP_023164614.1 competence type IV pilus minor pilin ComGD Machinery gene
  ABQ274_RS10550 (ABQ274_10550) comGE 2106225..2106521 (+) 297 WP_010906316.1 competence type IV pilus minor pilin ComGE Machinery gene
  ABQ274_RS10555 (ABQ274_10555) comGF 2106484..2106930 (+) 447 WP_031558968.1 competence type IV pilus minor pilin ComGF Machinery gene
  ABQ274_RS10560 (ABQ274_10560) comGG 2106969..2107253 (+) 285 WP_010906314.1 competence type IV pilus minor pilin ComGG Machinery gene
  ABQ274_RS10565 (ABQ274_10565) - 2107334..2107771 (+) 438 WP_010906313.1 zinc-dependent MarR family transcriptional regulator -
  ABQ274_RS10570 (ABQ274_10570) - 2107768..2108610 (+) 843 WP_015427160.1 metal ABC transporter substrate-binding protein -
  ABQ274_RS10575 (ABQ274_10575) - 2108787..2109524 (+) 738 WP_012898617.1 metal ABC transporter ATP-binding protein -
  ABQ274_RS10580 (ABQ274_10580) - 2109517..2110326 (+) 810 WP_010906310.1 metal ABC transporter permease -
  ABQ274_RS10585 (ABQ274_10585) - 2110365..2111231 (-) 867 WP_353726894.1 RluA family pseudouridine synthase -
  ABQ274_RS10590 (ABQ274_10590) - 2111436..2111813 (+) 378 WP_003129983.1 pyridoxamine 5'-phosphate oxidase family protein -

Sequence

Protein


Download         Length: 94 a.a.        Molecular weight: 10783.02 Da        Isoelectric Point: 5.0604

>NTDB_id=911199 ABQ274_RS10560 WP_010906314.1 2106969..2107253(+) (comGG) [Lactococcus lactis strain FNZ339]
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDEKTYQF
SIHLKDGANFQIKN

Nucleotide


Download         Length: 285 bp        

>NTDB_id=911199 ABQ274_RS10560 WP_010906314.1 2106969..2107253(+) (comGG) [Lactococcus lactis strain FNZ339]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAAAACTTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAATTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q9CDU4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

59.14

98.936

0.585