Detailed information
Bioinformatically predicted
Overview
| Name | pilV | Type | Machinery gene |
| Locus tag | SD209_RS21100 | Genome accession | NZ_CP138326 |
| Coordinates | 4408434..4408991 (+) | Length | 185 a.a. |
| NCBI ID | WP_003119423.1 | Uniprot ID | - |
| Organism | Pseudomonas aeruginosa strain JBPA | ||
| Function | assembly of type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 4407322..4464839 | 4408434..4408991 | within | 0 |
Gene organization within MGE regions
Location: 4407322..4464839
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SD209_RS21090 (SD209_21090) | - | 4407322..4407831 (+) | 510 | WP_003102595.1 | Tfp pilus assembly protein FimT/FimU | - |
| SD209_RS21095 (SD209_21095) | - | 4407937..4408443 (+) | 507 | WP_003102598.1 | Tfp pilus assembly protein FimT/FimU | - |
| SD209_RS21100 (SD209_21100) | pilV | 4408434..4408991 (+) | 558 | WP_003119423.1 | type 4a pilus minor pilin PilV | Machinery gene |
| SD209_RS21105 (SD209_21105) | pilW | 4408988..4409812 (+) | 825 | WP_003119422.1 | type 4a pilus minor pilin PilW | - |
| SD209_RS21110 (SD209_21110) | pilX | 4409809..4410396 (+) | 588 | WP_003112826.1 | type 4a pilus minor pilin PilX | - |
| SD209_RS21115 (SD209_21115) | pilY1 | 4410408..4413899 (+) | 3492 | WP_003123397.1 | type 4a pilus biogenesis protein PilY1 | - |
| SD209_RS21120 (SD209_21120) | pilY2 | 4413901..4414248 (+) | 348 | WP_012614546.1 | type 4a fimbrial biogenesis protein PilY2 | - |
| SD209_RS21125 (SD209_21125) | - | 4414245..4414322 (+) | 78 | Protein_4187 | type IV pilin protein | - |
| SD209_RS21130 (SD209_21130) | - | 4414447..4414806 (-) | 360 | WP_003094179.1 | Mor transcription activator family protein | - |
| SD209_RS21135 (SD209_21135) | - | 4414809..4415372 (-) | 564 | WP_003094181.1 | gp16 family protein | - |
| SD209_RS21140 (SD209_21140) | - | 4415359..4415826 (-) | 468 | WP_003094183.1 | hypothetical protein | - |
| SD209_RS21145 (SD209_21145) | - | 4415828..4416046 (-) | 219 | WP_003148480.1 | hypothetical protein | - |
| SD209_RS21150 (SD209_21150) | - | 4416048..4416737 (-) | 690 | WP_003094188.1 | DUF2786 domain-containing protein | - |
| SD209_RS21155 (SD209_21155) | - | 4416739..4417362 (-) | 624 | WP_003094190.1 | DUF3164 family protein | - |
| SD209_RS21160 (SD209_21160) | - | 4417355..4417555 (-) | 201 | WP_003094191.1 | hypothetical protein | - |
| SD209_RS21165 (SD209_21165) | - | 4417548..4417922 (-) | 375 | WP_003094193.1 | hypothetical protein | - |
| SD209_RS21170 (SD209_21170) | - | 4417922..4418203 (-) | 282 | WP_003094195.1 | hypothetical protein | - |
| SD209_RS21175 (SD209_21175) | - | 4418200..4418541 (-) | 342 | WP_031636330.1 | hypothetical protein | - |
| SD209_RS21180 (SD209_21180) | - | 4418543..4419712 (-) | 1170 | WP_023102419.1 | ExeA family protein | - |
| SD209_RS21185 (SD209_21185) | - | 4419712..4421490 (-) | 1779 | WP_318833305.1 | DDE-type integrase/transposase/recombinase | - |
| SD209_RS21190 (SD209_21190) | - | 4421495..4422451 (-) | 957 | WP_318833306.1 | hypothetical protein | - |
| SD209_RS21195 (SD209_21195) | - | 4422509..4422808 (-) | 300 | WP_031642102.1 | helix-turn-helix domain-containing protein | - |
| SD209_RS21200 (SD209_21200) | - | 4422805..4423065 (-) | 261 | WP_023132007.1 | hypothetical protein | - |
| SD209_RS21205 (SD209_21205) | - | 4423058..4423546 (-) | 489 | WP_033967144.1 | hypothetical protein | - |
| SD209_RS21210 (SD209_21210) | - | 4423666..4424376 (-) | 711 | WP_318833307.1 | hypothetical protein | - |
| SD209_RS21215 (SD209_21215) | - | 4424403..4424723 (+) | 321 | WP_318833308.1 | hypothetical protein | - |
| SD209_RS21220 (SD209_21220) | - | 4424769..4424978 (-) | 210 | WP_023657070.1 | DNA-binding protein | - |
| SD209_RS35070 | - | 4425077..4425514 (+) | 438 | WP_172907857.1 | helix-turn-helix domain-containing protein | - |
| SD209_RS21230 (SD209_21230) | - | 4425534..4425737 (+) | 204 | WP_003152183.1 | hypothetical protein | - |
| SD209_RS21235 (SD209_21235) | - | 4425710..4426465 (-) | 756 | WP_003094222.1 | hypothetical protein | - |
| SD209_RS21240 (SD209_21240) | - | 4426639..4426935 (+) | 297 | WP_003152187.1 | putative holin | - |
| SD209_RS21245 (SD209_21245) | - | 4426938..4427096 (+) | 159 | WP_003094227.1 | hypothetical protein | - |
| SD209_RS21250 (SD209_21250) | - | 4427093..4427722 (+) | 630 | WP_003094230.1 | transglycosylase SLT domain-containing protein | - |
| SD209_RS21255 (SD209_21255) | - | 4427909..4428520 (+) | 612 | WP_270140152.1 | lysis protein | - |
| SD209_RS21260 (SD209_21260) | - | 4428524..4428913 (+) | 390 | WP_003094234.1 | hypothetical protein | - |
| SD209_RS21265 (SD209_21265) | - | 4428903..4429211 (+) | 309 | WP_003094236.1 | hypothetical protein | - |
| SD209_RS21270 (SD209_21270) | - | 4429217..4429792 (+) | 576 | WP_003094238.1 | DUF3486 family protein | - |
| SD209_RS21275 (SD209_21275) | - | 4429794..4431497 (+) | 1704 | WP_023657074.1 | phage protein gp28 | - |
| SD209_RS21280 (SD209_21280) | - | 4431497..4432975 (+) | 1479 | WP_023657075.1 | DUF935 domain-containing protein | - |
| SD209_RS21285 (SD209_21285) | - | 4432975..4434225 (+) | 1251 | WP_003139984.1 | phage minor head protein | - |
| SD209_RS21290 (SD209_21290) | - | 4434222..4434791 (+) | 570 | WP_003139982.1 | phage virion morphogenesis protein | - |
| SD209_RS21295 (SD209_21295) | - | 4435010..4436248 (+) | 1239 | WP_003139980.1 | peptidase | - |
| SD209_RS21300 (SD209_21300) | - | 4436252..4436629 (+) | 378 | WP_023102437.1 | capsid cement protein | - |
| SD209_RS21305 (SD209_21305) | - | 4436641..4437570 (+) | 930 | WP_003139975.1 | hypothetical protein | - |
| SD209_RS21310 (SD209_21310) | - | 4437617..4437811 (+) | 195 | WP_003094256.1 | hypothetical protein | - |
| SD209_RS21315 (SD209_21315) | - | 4437811..4438137 (+) | 327 | WP_003094258.1 | hypothetical protein | - |
| SD209_RS21320 (SD209_21320) | - | 4438145..4438654 (+) | 510 | WP_023442966.1 | DUF1320 domain-containing protein | - |
| SD209_RS21325 (SD209_21325) | - | 4438656..4439111 (+) | 456 | WP_023657076.1 | hypothetical protein | - |
| SD209_RS21330 (SD209_21330) | - | 4439108..4439317 (+) | 210 | WP_003139972.1 | hypothetical protein | - |
| SD209_RS21335 (SD209_21335) | - | 4439321..4440073 (+) | 753 | WP_003094267.1 | hypothetical protein | - |
| SD209_RS21340 (SD209_21340) | - | 4440075..4440581 (+) | 507 | WP_003139971.1 | DUF6631 family protein | - |
| SD209_RS21345 (SD209_21345) | - | 4440578..4440721 (+) | 144 | WP_003094272.1 | hypothetical protein | - |
| SD209_RS21350 (SD209_21350) | - | 4440808..4444650 (+) | 3843 | WP_023657077.1 | phage tail length tape measure family protein | - |
| SD209_RS21355 (SD209_21355) | - | 4444658..4445614 (+) | 957 | WP_058199458.1 | hypothetical protein | - |
| SD209_RS21360 (SD209_21360) | - | 4445616..4446539 (+) | 924 | WP_012613801.1 | hypothetical protein | - |
| SD209_RS21365 (SD209_21365) | - | 4446539..4448242 (+) | 1704 | WP_003117242.1 | hypothetical protein | - |
| SD209_RS21370 (SD209_21370) | - | 4448232..4449053 (+) | 822 | WP_003117241.1 | phage BR0599 family protein | - |
| SD209_RS21375 (SD209_21375) | - | 4449062..4449301 (+) | 240 | WP_003094581.1 | hypothetical protein | - |
| SD209_RS21380 (SD209_21380) | - | 4449298..4449516 (+) | 219 | WP_003117240.1 | hypothetical protein | - |
| SD209_RS21385 (SD209_21385) | - | 4449506..4451713 (+) | 2208 | WP_318833309.1 | phage tail protein | - |
| SD209_RS21390 (SD209_21390) | - | 4451710..4452858 (+) | 1149 | WP_025921041.1 | hypothetical protein | - |
| SD209_RS21395 (SD209_21395) | - | 4452855..4453145 (+) | 291 | WP_023465148.1 | hypothetical protein | - |
| SD209_RS21400 (SD209_21400) | - | 4453224..4453448 (+) | 225 | WP_010791890.1 | hypothetical protein | - |
| SD209_RS21405 (SD209_21405) | - | 4453499..4453888 (+) | 390 | WP_318833310.1 | type IV pilin protein | - |
| SD209_RS21410 (SD209_21410) | ispH | 4453935..4454879 (-) | 945 | WP_003094724.1 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | - |
| SD209_RS21415 (SD209_21415) | fkpB | 4454965..4455405 (-) | 441 | WP_003102613.1 | FKBP-type peptidyl-prolyl cis-trans isomerase | - |
| SD209_RS21420 (SD209_21420) | lspA | 4455398..4455907 (-) | 510 | WP_003102615.1 | signal peptidase II | - |
| SD209_RS21425 (SD209_21425) | ileS | 4455900..4458731 (-) | 2832 | WP_003102617.1 | isoleucine--tRNA ligase | - |
| SD209_RS21430 (SD209_21430) | ribF | 4458755..4459693 (-) | 939 | WP_003102619.1 | bifunctional riboflavin kinase/FAD synthetase | - |
| SD209_RS21435 (SD209_21435) | murJ | 4459790..4461328 (-) | 1539 | WP_003102622.1 | murein biosynthesis integral membrane protein MurJ | - |
| SD209_RS21440 (SD209_21440) | rpsT | 4461612..4461887 (+) | 276 | WP_003094744.1 | 30S ribosomal protein S20 | - |
| SD209_RS21445 (SD209_21445) | - | 4461954..4462418 (-) | 465 | WP_003094746.1 | CreA family protein | - |
| SD209_RS21450 (SD209_21450) | proB | 4462430..4463548 (-) | 1119 | WP_003094756.1 | glutamate 5-kinase | - |
| SD209_RS21455 (SD209_21455) | cgtA | 4463619..4464839 (-) | 1221 | WP_003094758.1 | Obg family GTPase CgtA | - |
Sequence
Protein
Download Length: 185 a.a. Molecular weight: 20061.15 Da Isoelectric Point: 8.2255
>NTDB_id=901802 SD209_RS21100 WP_003119423.1 4408434..4408991(+) (pilV) [Pseudomonas aeruginosa strain JBPA]
MLLKSRHRSLHQSGFSMIEVLVALLLISIGVLGMIAMQGKTIQYTADSVERNKAAMLGSNLLESMRASPKALYDVKDQMA
TQSDFFKAKGSAFPTAPSSCTPLPDAIKDRLGCWAEQVKNELPGAGDLLKSDYYICRSSKPGDCDGKGSMLEIRLAWRGK
QGACVNAADSSADTSLCYYTLRVEP
MLLKSRHRSLHQSGFSMIEVLVALLLISIGVLGMIAMQGKTIQYTADSVERNKAAMLGSNLLESMRASPKALYDVKDQMA
TQSDFFKAKGSAFPTAPSSCTPLPDAIKDRLGCWAEQVKNELPGAGDLLKSDYYICRSSKPGDCDGKGSMLEIRLAWRGK
QGACVNAADSSADTSLCYYTLRVEP
Nucleotide
Download Length: 558 bp
>NTDB_id=901802 SD209_RS21100 WP_003119423.1 4408434..4408991(+) (pilV) [Pseudomonas aeruginosa strain JBPA]
ATGCTATTGAAATCGCGACACAGGTCGCTGCACCAATCCGGCTTCAGCATGATCGAAGTGCTGGTCGCCCTGCTGCTGAT
CAGCATCGGCGTGCTGGGCATGATCGCCATGCAGGGCAAGACCATCCAGTACACCGCCGACTCGGTCGAGCGCAACAAGG
CAGCCATGCTCGGCAGCAACCTGCTGGAAAGCATGCGGGCGAGCCCGAAGGCGCTGTACGACGTCAAGGACCAGATGGCC
ACGCAATCCGACTTCTTCAAGGCCAAGGGGTCGGCGTTCCCCACCGCGCCGTCCTCCTGCACGCCATTGCCCGACGCGAT
CAAGGACCGCCTGGGATGCTGGGCGGAACAGGTGAAGAACGAACTGCCAGGCGCTGGCGACCTGCTGAAGAGCGACTACT
ACATCTGCCGCAGCTCAAAGCCGGGCGACTGCGACGGCAAGGGCTCCATGCTGGAAATCCGCCTTGCCTGGCGCGGCAAG
CAAGGCGCCTGCGTCAACGCCGCCGACAGCAGCGCCGACACCTCCCTCTGCTACTACACCCTCAGGGTCGAGCCATGA
ATGCTATTGAAATCGCGACACAGGTCGCTGCACCAATCCGGCTTCAGCATGATCGAAGTGCTGGTCGCCCTGCTGCTGAT
CAGCATCGGCGTGCTGGGCATGATCGCCATGCAGGGCAAGACCATCCAGTACACCGCCGACTCGGTCGAGCGCAACAAGG
CAGCCATGCTCGGCAGCAACCTGCTGGAAAGCATGCGGGCGAGCCCGAAGGCGCTGTACGACGTCAAGGACCAGATGGCC
ACGCAATCCGACTTCTTCAAGGCCAAGGGGTCGGCGTTCCCCACCGCGCCGTCCTCCTGCACGCCATTGCCCGACGCGAT
CAAGGACCGCCTGGGATGCTGGGCGGAACAGGTGAAGAACGAACTGCCAGGCGCTGGCGACCTGCTGAAGAGCGACTACT
ACATCTGCCGCAGCTCAAAGCCGGGCGACTGCGACGGCAAGGGCTCCATGCTGGAAATCCGCCTTGCCTGGCGCGGCAAG
CAAGGCGCCTGCGTCAACGCCGCCGACAGCAGCGCCGACACCTCCCTCTGCTACTACACCCTCAGGGTCGAGCCATGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilV | Pseudomonas aeruginosa PAK |
99.459 |
100 |
0.995 |