Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   ABC811_RS07660 Genome accession   NZ_CP155535
Coordinates   1484606..1484755 (-) Length   49 a.a.
NCBI ID   WP_001818346.1    Uniprot ID   Q9FBH1
Organism   Streptococcus pneumoniae strain PJ755/1     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 1479606..1489755
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABC811_RS07625 (ABC811_07620) trmB 1479954..1480589 (-) 636 WP_001266083.1 tRNA (guanosine(46)-N7)-methyltransferase TrmB -
  ABC811_RS07630 (ABC811_07625) ccrZ 1480586..1481380 (-) 795 WP_000363002.1 cell cycle regulator CcrZ -
  ABC811_RS07635 (ABC811_07630) - 1481541..1482152 (-) 612 WP_000394044.1 type II CAAX endopeptidase family protein -
  ABC811_RS07640 (ABC811_07635) blpZ 1482182..1482430 (-) 249 WP_000276500.1 immunity protein BlpZ -
  ABC811_RS07645 (ABC811_07640) - 1482472..1483161 (-) 690 WP_000760515.1 CPBP family intramembrane glutamic endopeptidase -
  ABC811_RS07650 (ABC811_07645) - 1483199..1483597 (-) 399 WP_000877383.1 hypothetical protein -
  ABC811_RS07655 (ABC811_07650) - 1484383..1484502 (-) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  ABC811_RS07660 (ABC811_07655) cipB 1484606..1484755 (-) 150 WP_001818346.1 bacteriocin-like peptide BlpO Regulator
  ABC811_RS07665 (ABC811_07660) blpN 1484999..1485202 (-) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  ABC811_RS07670 (ABC811_07665) blpM 1485218..1485472 (-) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  ABC811_RS07680 (ABC811_07675) - 1486683..1487497 (+) 815 Protein_1519 IS5-like element IS1515 family transposase -
  ABC811_RS07685 (ABC811_07680) - 1487511..1487906 (-) 396 WP_000846569.1 hypothetical protein -
  ABC811_RS07690 (ABC811_07685) - 1487903..1488067 (-) 165 WP_000727118.1 hypothetical protein -
  ABC811_RS07695 (ABC811_07690) - 1488366..1488485 (-) 120 WP_001844187.1 PncF family bacteriocin immunity protein -
  ABC811_RS07700 (ABC811_07695) blpU 1488488..1488718 (-) 231 WP_000379964.1 bacteriocin-like peptide BlpU -
  ABC811_RS07705 (ABC811_07700) blpJ 1488787..1489056 (-) 270 WP_001093248.1 bacteriocin-like peptide BlpJ -
  ABC811_RS07710 (ABC811_07705) blpI 1489523..1489720 (-) 198 WP_001093259.1 bacteriocin-like peptide BlpI -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5134.91 Da        Isoelectric Point: 3.9133

>NTDB_id=897057 ABC811_RS07660 WP_001818346.1 1484606..1484755(-) (cipB) [Streptococcus pneumoniae strain PJ755/1]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=897057 ABC811_RS07660 WP_001818346.1 1484606..1484755(-) (cipB) [Streptococcus pneumoniae strain PJ755/1]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q9FBH1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51