Detailed information
Overview
| Name | comGD/cglD | Type | Machinery gene |
| Locus tag | R4703_RS04570 | Genome accession | NZ_CP137100 |
| Coordinates | 835630..836034 (-) | Length | 134 a.a. |
| NCBI ID | WP_000588023.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain LYP | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 836784..888642 | 835630..836034 | flank | 750 |
Gene organization within MGE regions
Location: 835630..888642
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| R4703_RS04570 | comGD/cglD | 835630..836034 (-) | 405 | WP_000588023.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| R4703_RS04575 | comGC/cglC | 836027..836293 (-) | 267 | WP_050129046.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| R4703_RS04580 | - | 836295..836552 (-) | 258 | WP_000698513.1 | hypothetical protein | - |
| R4703_RS04585 | - | 836784..837740 (-) | 957 | WP_219576515.1 | N-acetylmuramoyl-L-alanine amidase family protein | - |
| R4703_RS04590 | - | 837743..838078 (-) | 336 | WP_050200954.1 | phage holin | - |
| R4703_RS04595 | - | 838082..838381 (-) | 300 | WP_001811580.1 | hypothetical protein | - |
| R4703_RS04600 | - | 838390..838740 (-) | 351 | WP_000852245.1 | hypothetical protein | - |
| R4703_RS04605 | - | 838743..838946 (-) | 204 | WP_001091112.1 | hypothetical protein | - |
| R4703_RS04610 | - | 838927..839044 (-) | 118 | Protein_882 | dihydrodipicolinate reductase | - |
| R4703_RS04615 | - | 839041..845439 (-) | 6399 | WP_317818026.1 | tail fiber domain-containing protein | - |
| R4703_RS04620 | - | 845444..845794 (-) | 351 | WP_000068025.1 | DUF6711 family protein | - |
| R4703_RS04625 | - | 845803..849456 (-) | 3654 | WP_317818031.1 | hypothetical protein | - |
| R4703_RS04630 | - | 849443..849793 (-) | 351 | WP_050199219.1 | hypothetical protein | - |
| R4703_RS04635 | - | 849832..850212 (-) | 381 | WP_023396733.1 | DUF6096 family protein | - |
| R4703_RS04640 | - | 850217..850630 (-) | 414 | WP_000880666.1 | phage tail tube protein | - |
| R4703_RS04645 | - | 850633..851001 (-) | 369 | WP_050141942.1 | hypothetical protein | - |
| R4703_RS04650 | - | 850998..851513 (-) | 516 | WP_050105871.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| R4703_RS04655 | - | 851488..851826 (-) | 339 | WP_050118024.1 | hypothetical protein | - |
| R4703_RS04660 | - | 851807..852118 (-) | 312 | WP_317818032.1 | phage head-tail connector protein | - |
| R4703_RS04665 | - | 852120..852308 (-) | 189 | WP_000669348.1 | hypothetical protein | - |
| R4703_RS04670 | - | 852318..853343 (-) | 1026 | WP_317818033.1 | carbohydrate-binding protein | - |
| R4703_RS04675 | - | 853366..853881 (-) | 516 | WP_050201111.1 | DUF4355 domain-containing protein | - |
| R4703_RS04680 | - | 854049..854300 (-) | 252 | WP_050167231.1 | DUF6275 family protein | - |
| R4703_RS04685 | - | 854302..854547 (-) | 246 | WP_000877357.1 | hypothetical protein | - |
| R4703_RS04690 | - | 854599..854826 (-) | 228 | WP_050168037.1 | hypothetical protein | - |
| R4703_RS04695 | - | 854814..856217 (-) | 1404 | WP_224782169.1 | minor capsid protein | - |
| R4703_RS04700 | - | 856126..857595 (-) | 1470 | WP_000285394.1 | phage portal protein | - |
| R4703_RS04705 | - | 857607..858821 (-) | 1215 | WP_050140470.1 | PBSX family phage terminase large subunit | - |
| R4703_RS04710 | - | 858811..859305 (-) | 495 | WP_000351060.1 | terminase small subunit | - |
| R4703_RS04720 | - | 860608..861030 (-) | 423 | WP_317818037.1 | DUF1492 domain-containing protein | - |
| R4703_RS04725 | - | 861102..861473 (-) | 372 | WP_317818039.1 | hypothetical protein | - |
| R4703_RS04730 | - | 861470..861790 (-) | 321 | WP_055386256.1 | hypothetical protein | - |
| R4703_RS04735 | - | 862046..862225 (-) | 180 | WP_001042650.1 | hypothetical protein | - |
| R4703_RS04740 | - | 862218..862712 (-) | 495 | WP_233922966.1 | YopX family protein | - |
| R4703_RS04745 | - | 862709..863227 (-) | 519 | WP_233922967.1 | DUF1642 domain-containing protein | - |
| R4703_RS04750 | - | 863229..863546 (-) | 318 | WP_174222359.1 | hypothetical protein | - |
| R4703_RS04755 | - | 863571..863753 (-) | 183 | WP_050245501.1 | hypothetical protein | - |
| R4703_RS04760 | - | 863769..864200 (-) | 432 | WP_000779143.1 | RusA family crossover junction endodeoxyribonuclease | - |
| R4703_RS04765 | - | 864197..864526 (-) | 330 | WP_050210841.1 | hypothetical protein | - |
| R4703_RS04770 | - | 864540..864749 (-) | 210 | WP_000455269.1 | hypothetical protein | - |
| R4703_RS04775 | - | 864751..865446 (-) | 696 | WP_050099130.1 | site-specific DNA-methyltransferase | - |
| R4703_RS04780 | ssbA | 865459..865875 (-) | 417 | WP_050201984.1 | single-stranded DNA-binding protein | Machinery gene |
| R4703_RS04785 | - | 865865..866008 (-) | 144 | WP_153277088.1 | hypothetical protein | - |
| R4703_RS04790 | - | 866011..867075 (-) | 1065 | WP_219576743.1 | DUF1351 domain-containing protein | - |
| R4703_RS04795 | bet | 867085..867837 (-) | 753 | WP_050263779.1 | phage recombination protein Bet | - |
| R4703_RS04800 | - | 867855..868040 (-) | 186 | WP_000746960.1 | hypothetical protein | - |
| R4703_RS04805 | - | 868294..868554 (-) | 261 | WP_219576744.1 | hypothetical protein | - |
| R4703_RS04810 | - | 868567..868821 (-) | 255 | WP_000275521.1 | hypothetical protein | - |
| R4703_RS04815 | - | 868822..869043 (-) | 222 | WP_001864263.1 | hypothetical protein | - |
| R4703_RS04820 | - | 869043..869204 (-) | 162 | WP_000823399.1 | BOW99_gp33 family protein | - |
| R4703_RS04825 | - | 869269..869412 (-) | 144 | WP_000389589.1 | hypothetical protein | - |
| R4703_RS04830 | - | 869529..869753 (+) | 225 | WP_000517704.1 | DUF2188 domain-containing protein | - |
| R4703_RS04835 | - | 869750..869932 (-) | 183 | WP_001247797.1 | hypothetical protein | - |
| R4703_RS04840 | - | 870114..870392 (-) | 279 | WP_000261154.1 | HTH domain-containing protein | - |
| R4703_RS04845 | - | 870559..870795 (-) | 237 | WP_001157069.1 | hypothetical protein | - |
| R4703_RS04850 | - | 870869..870994 (+) | 126 | WP_257885839.1 | hypothetical protein | - |
| R4703_RS04855 | - | 870987..871286 (-) | 300 | WP_191855094.1 | hypothetical protein | - |
| R4703_RS04860 | - | 871361..871636 (-) | 276 | WP_050202804.1 | hypothetical protein | - |
| R4703_RS04865 | - | 871797..872549 (+) | 753 | WP_219566337.1 | XRE family transcriptional regulator | - |
| R4703_RS04870 | - | 872551..873315 (+) | 765 | WP_219576745.1 | hypothetical protein | - |
| R4703_RS04875 | - | 873622..875067 (+) | 1446 | WP_317818056.1 | recombinase family protein | - |
| R4703_RS04885 | comGB/cglB | 875149..876165 (-) | 1017 | WP_073177425.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| R4703_RS04890 | comGA/cglA/cilD | 876113..877054 (-) | 942 | WP_000249559.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| R4703_RS04895 | - | 877130..877495 (-) | 366 | WP_000286415.1 | DUF1033 family protein | - |
| R4703_RS04900 | - | 877762..879017 (+) | 1256 | WP_370657740.1 | ISL3 family transposase | - |
| R4703_RS04905 | - | 879066..880124 (-) | 1059 | WP_000649468.1 | zinc-dependent alcohol dehydrogenase family protein | - |
| R4703_RS04910 | nagA | 880287..881438 (-) | 1152 | WP_001134457.1 | N-acetylglucosamine-6-phosphate deacetylase | - |
| R4703_RS04915 | - | 881591..883408 (-) | 1818 | WP_001220918.1 | acyltransferase family protein | - |
| R4703_RS04920 | tgt | 883506..884648 (-) | 1143 | WP_001285241.1 | tRNA guanosine(34) transglycosylase Tgt | - |
| R4703_RS04925 | - | 884778..885635 (+) | 858 | WP_001108866.1 | DUF975 family protein | - |
| R4703_RS04930 | pcp | 885663..886280 (-) | 618 | Protein_944 | pyroglutamyl-peptidase I | - |
| R4703_RS04935 | - | 886387..886745 (-) | 359 | Protein_945 | DUF1304 domain-containing protein | - |
| R4703_RS04940 | - | 886756..887180 (-) | 425 | Protein_946 | MarR family winged helix-turn-helix transcriptional regulator | - |
| R4703_RS04945 | - | 887500..888642 (-) | 1143 | WP_001842127.1 | LysM domain-containing protein | - |
Sequence
Protein
Download Length: 134 a.a. Molecular weight: 14638.82 Da Isoelectric Point: 10.2164
>NTDB_id=895100 R4703_RS04570 WP_000588023.1 835630..836034(-) (comGD/cglD) [Streptococcus pneumoniae strain LYP]
MIKAFTMLESLLVLGLVSILALGLSGSVQSTFAAVEEQIFFMEFEELYRETQKRSVASQQKTSLNLDGQTLSNGSQKLTV
PKGIQAPSGQSITFDRAGGNSSLAKVEFQTSKGAIRYQLYLGNGKIKRIKETKN
MIKAFTMLESLLVLGLVSILALGLSGSVQSTFAAVEEQIFFMEFEELYRETQKRSVASQQKTSLNLDGQTLSNGSQKLTV
PKGIQAPSGQSITFDRAGGNSSLAKVEFQTSKGAIRYQLYLGNGKIKRIKETKN
Nucleotide
Download Length: 405 bp
>NTDB_id=895100 R4703_RS04570 WP_000588023.1 835630..836034(-) (comGD/cglD) [Streptococcus pneumoniae strain LYP]
ATGATTAAGGCCTTTACCATGCTGGAAAGTCTCTTGGTTTTGGGTCTTGTGAGTATCCTTGCCTTGGGCTTGTCCGGCTC
TGTTCAGTCCACTTTTGCGGCGGTAGAGGAACAGATTTTCTTTATGGAGTTTGAAGAACTCTATCGGGAAACCCAAAAAC
GCAGTGTAGCCAGTCAGCAAAAGACTAGTCTGAACTTAGATGGGCAGACGCTTAGCAATGGCAGTCAAAAGTTGACAGTT
CCTAAAGGAATTCAGGCACCATCAGGCCAAAGTATTACATTTGACCGAGCTGGGGGCAATTCGTCCCTGGCTAAGGTTGA
ATTTCAGACCAGTAAAGGAGCGATTCGCTATCAATTATATCTAGGAAATGGAAAAATTAAACGCATTAAGGAAACAAAAA
ATTAG
ATGATTAAGGCCTTTACCATGCTGGAAAGTCTCTTGGTTTTGGGTCTTGTGAGTATCCTTGCCTTGGGCTTGTCCGGCTC
TGTTCAGTCCACTTTTGCGGCGGTAGAGGAACAGATTTTCTTTATGGAGTTTGAAGAACTCTATCGGGAAACCCAAAAAC
GCAGTGTAGCCAGTCAGCAAAAGACTAGTCTGAACTTAGATGGGCAGACGCTTAGCAATGGCAGTCAAAAGTTGACAGTT
CCTAAAGGAATTCAGGCACCATCAGGCCAAAGTATTACATTTGACCGAGCTGGGGGCAATTCGTCCCTGGCTAAGGTTGA
ATTTCAGACCAGTAAAGGAGCGATTCGCTATCAATTATATCTAGGAAATGGAAAAATTAAACGCATTAAGGAAACAAAAA
ATTAG
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGD/cglD | Streptococcus pneumoniae TIGR4 |
98.507 |
100 |
0.985 |
| comGD/cglD | Streptococcus pneumoniae Rx1 |
97.761 |
100 |
0.978 |
| comGD/cglD | Streptococcus pneumoniae D39 |
97.761 |
100 |
0.978 |
| comGD/cglD | Streptococcus pneumoniae R6 |
97.761 |
100 |
0.978 |
| comGD/cglD | Streptococcus mitis SK321 |
97.015 |
100 |
0.97 |
| comGD/cglD | Streptococcus mitis NCTC 12261 |
97.744 |
99.254 |
0.97 |
| comYD | Streptococcus gordonii str. Challis substr. CH1 |
58.268 |
94.776 |
0.552 |
| comYD | Streptococcus mutans UA140 |
49.219 |
95.522 |
0.47 |
| comYD | Streptococcus mutans UA159 |
49.219 |
95.522 |
0.47 |