Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   RS399_RS16095 Genome accession   NZ_CP135973
Coordinates   3221378..3221518 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus inaquosorum strain SI3     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3216378..3226518
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RS399_RS16065 (RS399_16065) - 3216673..3217071 (+) 399 WP_084991312.1 YueI family protein -
  RS399_RS16070 (RS399_16070) - 3217168..3217719 (+) 552 WP_084991314.1 cysteine hydrolase family protein -
  RS399_RS16075 (RS399_16075) - 3217735..3219207 (+) 1473 WP_019259336.1 nicotinate phosphoribosyltransferase -
  RS399_RS16080 (RS399_16080) pdeH 3219345..3220574 (+) 1230 WP_084991316.1 cyclic di-GMP phosphodiesterase -
  RS399_RS16085 (RS399_16085) - 3220550..3220918 (-) 369 WP_084991317.1 hypothetical protein -
  RS399_RS16090 (RS399_16090) - 3221031..3221198 (-) 168 WP_142271075.1 hypothetical protein -
  RS399_RS16095 (RS399_16095) degQ 3221378..3221518 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  RS399_RS16100 (RS399_16100) - 3221703..3222563 (+) 861 WP_084991345.1 polyprenyl synthetase family protein -
  RS399_RS16105 (RS399_16105) comX 3222576..3222740 (+) 165 WP_015384519.1 competence pheromone ComX -
  RS399_RS16110 (RS399_16110) comP 3222752..3225052 (+) 2301 WP_100276228.1 histidine kinase Regulator
  RS399_RS16115 (RS399_16115) comA 3225133..3225777 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  RS399_RS16120 (RS399_16120) - 3225796..3226176 (+) 381 WP_019259331.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=888033 RS399_RS16095 WP_003220708.1 3221378..3221518(+) (degQ) [Bacillus inaquosorum strain SI3]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=888033 RS399_RS16095 WP_003220708.1 3221378..3221518(+) (degQ) [Bacillus inaquosorum strain SI3]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACAACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATACAATTACGCAATGAAAATTTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1