Detailed information NTG0887884

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: RS960_RS07465
• Genome accession: NZ_CP135966
• Coordinates: 1536682..1536993 (-)
• Length: 103 a.a.
• NCBI ID: WP_262538680.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain ST5477
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1531682..1541993

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
RS960_RS07430 (RS960_07430)	gcvPA	1532184..1533530 (-)	1347	WP_115305438.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
RS960_RS07435 (RS960_07435)	gcvT	1533550..1534641 (-)	1092	WP_262538681.1	glycine cleavage system aminomethyltransferase GcvT	-
RS960_RS07440 (RS960_07440)	-	1534800..1535324 (-)	525	WP_001015120.1	shikimate kinase	-
RS960_RS07445 (RS960_07445)	-	1535314..1535460 (-)	147	WP_001789879.1	hypothetical protein	-
RS960_RS07450 (RS960_07450)	comGF	1535557..1536054 (-)	498	WP_258411170.1	competence type IV pilus minor pilin ComGF	Machinery gene
RS960_RS07455 (RS960_07455)	comGE	1535972..1536271 (-)	300	WP_000844413.1	hypothetical protein	Machinery gene
RS960_RS07460 (RS960_07460)	comGD	1536258..1536704 (-)	447	WP_001796473.1	competence type IV pilus minor pilin ComGD	Machinery gene
RS960_RS07465 (RS960_07465)	comGC	1536682..1536993 (-)	312	WP_262538680.1	competence type IV pilus major pilin ComGC	Machinery gene
RS960_RS07470 (RS960_07470)	comGB	1537007..1538077 (-)	1071	WP_262538679.1	competence type IV pilus assembly protein ComGB	Machinery gene
RS960_RS07475 (RS960_07475)	comGA	1538049..1539011 (-)	963	WP_317528597.1	competence type IV pilus ATPase ComGA	Machinery gene
RS960_RS07480 (RS960_07480)	-	1539063..1539686 (-)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
RS960_RS07485 (RS960_07485)	-	1539683..1540012 (-)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
RS960_RS07490 (RS960_07490)	-	1540012..1540998 (-)	987	WP_000161315.1	ROK family glucokinase	-
RS960_RS07495 (RS960_07495)	-	1540995..1541198 (-)	204	WP_000087561.1	YqgQ family protein	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11343.41 Da
• Isoelectric Point: 8.5268

>NTDB_id=887884 RS960_RS07465 WP_262538680.1 1536682..1536993(-) (comGC) [Staphylococcus aureus strain ST5477]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYVLKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=887884 RS960_RS07465 WP_262538680.1 1536682..1536993(-) (comGC) [Staphylococcus aureus strain ST5477]
ATGTTTAAATTTCTAAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGTATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGTGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	99.029	100	0.99
comGC	Staphylococcus aureus MW2	99.029	100	0.99
comGC/cglC	Streptococcus mitis SK321	47.059	99.029	0.466
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369