Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | WOC48_RS00595 | Genome accession | NZ_CP150777 |
| Coordinates | 111930..112241 (+) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | A0A0H2XGS7 |
| Organism | Staphylococcus aureus strain TUM20825 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 106930..117241
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WOC48_RS00565 (WOC48_00560) | - | 107713..107916 (+) | 204 | WP_000087561.1 | YqgQ family protein | - |
| WOC48_RS00570 (WOC48_00565) | - | 107913..108899 (+) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| WOC48_RS00575 (WOC48_00570) | - | 108899..109228 (+) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| WOC48_RS00580 (WOC48_00575) | - | 109225..109848 (+) | 624 | WP_001223010.1 | MBL fold metallo-hydrolase | - |
| WOC48_RS00585 (WOC48_00580) | comGA | 109900..110874 (+) | 975 | WP_000697220.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| WOC48_RS00590 (WOC48_00585) | comGB | 110846..111916 (+) | 1071 | WP_000776422.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| WOC48_RS00595 (WOC48_00590) | comGC | 111930..112241 (+) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| WOC48_RS00600 (WOC48_00595) | comGD | 112219..112665 (+) | 447 | WP_001788899.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| WOC48_RS00605 (WOC48_00600) | comGE | 112652..112951 (+) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| WOC48_RS00610 (WOC48_00605) | comGF | 112869..113366 (+) | 498 | WP_001789864.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| WOC48_RS00615 (WOC48_00610) | - | 113463..113609 (+) | 147 | WP_001789879.1 | hypothetical protein | - |
| WOC48_RS00620 (WOC48_00615) | - | 113599..114123 (+) | 525 | WP_001015121.1 | shikimate kinase | - |
| WOC48_RS00625 (WOC48_00620) | gcvT | 114282..115373 (+) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| WOC48_RS00630 (WOC48_00625) | gcvPA | 115393..116739 (+) | 1347 | WP_117200971.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=879787 WOC48_RS00595 WP_000472256.1 111930..112241(+) (comGC) [Staphylococcus aureus strain TUM20825]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=879787 WOC48_RS00595 WP_000472256.1 111930..112241(+) (comGC) [Staphylococcus aureus strain TUM20825]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comGC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comGC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |