Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   RB208_RS15000 Genome accession   NZ_CP133147
Coordinates   3037510..3037650 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain Bacillius velezensis JYC520     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3032510..3042650
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RB208_RS14975 (RB208_14960) - 3032856..3033239 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  RB208_RS14980 (RB208_14965) comA 3033261..3033905 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  RB208_RS14985 (RB208_14970) comP 3033986..3036286 (-) 2301 WP_032876801.1 histidine kinase Regulator
  RB208_RS14990 (RB208_14975) comX 3036300..3036473 (-) 174 WP_012118314.1 competence pheromone ComX -
  RB208_RS14995 (RB208_14980) - 3036442..3037302 (-) 861 WP_142925231.1 polyprenyl synthetase family protein -
  RB208_RS15000 (RB208_14985) degQ 3037510..3037650 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  RB208_RS15005 (RB208_14990) - 3038116..3038457 (+) 342 WP_032876795.1 hypothetical protein -
  RB208_RS15010 (RB208_14995) - 3038464..3039687 (-) 1224 WP_032876792.1 EAL and HDOD domain-containing protein -
  RB208_RS15015 (RB208_15000) - 3039817..3041283 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  RB208_RS15020 (RB208_15005) - 3041301..3041852 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  RB208_RS15025 (RB208_15010) - 3041949..3042347 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=872123 RB208_RS15000 WP_003152043.1 3037510..3037650(-) (degQ) [Bacillus velezensis strain Bacillius velezensis JYC520]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=872123 RB208_RS15000 WP_003152043.1 3037510..3037650(-) (degQ) [Bacillus velezensis strain Bacillius velezensis JYC520]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891