Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | QYM01_RS04600 | Genome accession | NZ_CP129527 |
| Coordinates | 960506..960694 (+) | Length | 62 a.a. |
| NCBI ID | WP_050317117.1 | Uniprot ID | - |
| Organism | Streptococcus equi subsp. zooepidemicus strain BJ-1 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 927838..968265 | 960506..960694 | within | 0 |
Gene organization within MGE regions
Location: 927838..968265
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QYM01_RS04340 (QYM01_04340) | - | 927838..928926 (-) | 1089 | WP_050316838.1 | site-specific integrase | - |
| QYM01_RS04345 (QYM01_04345) | - | 929048..929323 (-) | 276 | WP_050317028.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| QYM01_RS04350 (QYM01_04350) | - | 929313..929531 (-) | 219 | WP_050315896.1 | DUF6290 family protein | - |
| QYM01_RS04355 (QYM01_04355) | - | 929547..930353 (-) | 807 | WP_228274451.1 | helix-turn-helix transcriptional regulator | - |
| QYM01_RS04360 (QYM01_04360) | - | 930522..930755 (+) | 234 | WP_050316417.1 | DUF739 family protein | - |
| QYM01_RS04365 (QYM01_04365) | - | 930770..930910 (+) | 141 | WP_165620210.1 | hypothetical protein | - |
| QYM01_RS04370 (QYM01_04370) | - | 930890..931264 (-) | 375 | WP_023610946.1 | DUF2513 domain-containing protein | - |
| QYM01_RS04375 (QYM01_04375) | - | 931313..931447 (+) | 135 | WP_266095843.1 | hypothetical protein | - |
| QYM01_RS04380 (QYM01_04380) | - | 931444..931668 (-) | 225 | WP_050316937.1 | hypothetical protein | - |
| QYM01_RS04385 (QYM01_04385) | - | 931723..932448 (+) | 726 | WP_050316936.1 | phage antirepressor KilAC domain-containing protein | - |
| QYM01_RS04390 (QYM01_04390) | - | 932664..932954 (+) | 291 | WP_037578536.1 | MerR family transcriptional regulator | - |
| QYM01_RS04395 (QYM01_04395) | - | 933100..933912 (+) | 813 | WP_050316935.1 | phage replisome organizer N-terminal domain-containing protein | - |
| QYM01_RS04400 (QYM01_04400) | - | 933899..934681 (+) | 783 | WP_043983621.1 | ATP-binding protein | - |
| QYM01_RS04405 (QYM01_04405) | - | 934818..935030 (+) | 213 | WP_043983620.1 | hypothetical protein | - |
| QYM01_RS04410 (QYM01_04410) | - | 935094..935486 (+) | 393 | WP_301900588.1 | YopX family protein | - |
| QYM01_RS04415 (QYM01_04415) | - | 935483..935695 (+) | 213 | WP_282724136.1 | hypothetical protein | - |
| QYM01_RS04420 (QYM01_04420) | - | 935743..935970 (+) | 228 | WP_301900590.1 | hypothetical protein | - |
| QYM01_RS04425 (QYM01_04425) | - | 935974..936465 (+) | 492 | WP_301900592.1 | class I SAM-dependent methyltransferase | - |
| QYM01_RS04430 (QYM01_04430) | - | 936462..937214 (+) | 753 | WP_301900594.1 | DNA methyltransferase | - |
| QYM01_RS04435 (QYM01_04435) | - | 937211..937429 (+) | 219 | WP_043983613.1 | hypothetical protein | - |
| QYM01_RS04440 (QYM01_04440) | - | 937429..937860 (+) | 432 | WP_301900737.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| QYM01_RS04445 (QYM01_04445) | - | 937998..938564 (+) | 567 | WP_301900596.1 | tyrosine-type recombinase/integrase | - |
| QYM01_RS04450 (QYM01_04450) | - | 938728..939066 (+) | 339 | WP_043983611.1 | HNH endonuclease signature motif containing protein | - |
| QYM01_RS04455 (QYM01_04455) | - | 939203..940465 (+) | 1263 | WP_037578510.1 | hypothetical protein | - |
| QYM01_RS04460 (QYM01_04460) | - | 940458..941855 (+) | 1398 | WP_301900598.1 | hypothetical protein | - |
| QYM01_RS04465 (QYM01_04465) | - | 941845..942138 (+) | 294 | WP_043983608.1 | hypothetical protein | - |
| QYM01_RS04470 (QYM01_04470) | - | 942192..942416 (+) | 225 | WP_043983607.1 | hypothetical protein | - |
| QYM01_RS04475 (QYM01_04475) | - | 942418..942675 (+) | 258 | WP_043983606.1 | DUF6275 family protein | - |
| QYM01_RS04480 (QYM01_04480) | - | 942768..944183 (+) | 1416 | WP_111690080.1 | terminase | - |
| QYM01_RS04485 (QYM01_04485) | - | 944258..944713 (+) | 456 | WP_037578498.1 | phage scaffold protein | - |
| QYM01_RS04490 (QYM01_04490) | - | 944717..945607 (+) | 891 | WP_043053013.1 | phage major capsid protein | - |
| QYM01_RS04495 (QYM01_04495) | - | 945610..945822 (+) | 213 | WP_301900601.1 | HeH/LEM domain-containing protein | - |
| QYM01_RS04500 (QYM01_04500) | - | 945873..946271 (+) | 399 | WP_301900602.1 | phage Gp19/Gp15/Gp42 family protein | - |
| QYM01_RS04505 (QYM01_04505) | - | 946258..946596 (+) | 339 | WP_301900603.1 | hypothetical protein | - |
| QYM01_RS04510 (QYM01_04510) | - | 946589..946825 (+) | 237 | WP_231196530.1 | hypothetical protein | - |
| QYM01_RS04515 (QYM01_04515) | - | 946826..947161 (+) | 336 | WP_043053018.1 | hypothetical protein | - |
| QYM01_RS04520 (QYM01_04520) | - | 947178..947759 (+) | 582 | WP_301900605.1 | phage tail protein | - |
| QYM01_RS04525 (QYM01_04525) | - | 947770..948033 (+) | 264 | WP_111678027.1 | hypothetical protein | - |
| QYM01_RS04530 (QYM01_04530) | - | 948048..948419 (+) | 372 | WP_301900607.1 | DUF5361 domain-containing protein | - |
| QYM01_RS04535 (QYM01_04535) | - | 948419..950779 (+) | 2361 | WP_301900608.1 | hypothetical protein | - |
| QYM01_RS04540 (QYM01_04540) | - | 950776..951471 (+) | 696 | WP_301900609.1 | hypothetical protein | - |
| QYM01_RS04545 (QYM01_04545) | - | 951453..953414 (+) | 1962 | WP_301900611.1 | phage tail spike protein | - |
| QYM01_RS04550 (QYM01_04550) | - | 953414..954088 (+) | 675 | WP_301900612.1 | collagen-like protein | - |
| QYM01_RS04555 (QYM01_04555) | - | 954090..954704 (+) | 615 | WP_301900613.1 | hypothetical protein | - |
| QYM01_RS04560 (QYM01_04560) | - | 954715..956604 (+) | 1890 | WP_301900615.1 | gp58-like family protein | - |
| QYM01_RS04565 (QYM01_04565) | - | 956618..956776 (+) | 159 | WP_231147251.1 | hypothetical protein | - |
| QYM01_RS04570 (QYM01_04570) | - | 956779..957393 (+) | 615 | WP_301900616.1 | DUF1366 domain-containing protein | - |
| QYM01_RS04575 (QYM01_04575) | - | 957406..957696 (+) | 291 | WP_012679338.1 | hypothetical protein | - |
| QYM01_RS04580 (QYM01_04580) | - | 957699..957878 (+) | 180 | WP_064056104.1 | hypothetical protein | - |
| QYM01_RS04585 (QYM01_04585) | - | 957990..959201 (+) | 1212 | WP_165619564.1 | glucosaminidase domain-containing protein | - |
| QYM01_RS04590 (QYM01_04590) | - | 959582..960157 (+) | 576 | WP_012679345.1 | phospholipase A2 SlaA | - |
| QYM01_RS04595 (QYM01_04595) | - | 960151..960438 (+) | 288 | WP_011106694.1 | hypothetical protein | - |
| QYM01_RS04600 (QYM01_04600) | prx | 960506..960694 (+) | 189 | WP_050317117.1 | Paratox | Regulator |
| QYM01_RS04610 (QYM01_04610) | - | 961289..961900 (+) | 612 | WP_301900658.1 | TVP38/TMEM64 family protein | - |
| QYM01_RS04615 (QYM01_04615) | - | 961947..962741 (-) | 795 | WP_111678034.1 | ABC transporter permease | - |
| QYM01_RS04620 (QYM01_04620) | - | 962751..963449 (-) | 699 | WP_301900660.1 | ABC transporter ATP-binding protein | - |
| QYM01_RS04625 (QYM01_04625) | - | 963449..963820 (-) | 372 | WP_037578443.1 | GntR family transcriptional regulator | - |
| QYM01_RS04630 (QYM01_04630) | - | 964062..967172 (+) | 3111 | WP_165627297.1 | DNA polymerase III subunit alpha | - |
| QYM01_RS04635 (QYM01_04635) | pfkA | 967252..968265 (+) | 1014 | WP_037578437.1 | 6-phosphofructokinase | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7281.27 Da Isoelectric Point: 5.0079
>NTDB_id=853990 QYM01_RS04600 WP_050317117.1 960506..960694(+) (prx) [Streptococcus equi subsp. zooepidemicus strain BJ-1]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHESVRSWEVVTEERVEAVLKELHYIK
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHESVRSWEVVTEERVEAVLKELHYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=853990 QYM01_RS04600 WP_050317117.1 960506..960694(+) (prx) [Streptococcus equi subsp. zooepidemicus strain BJ-1]
GTGTTAACATACGACGAGTTTAAGCAGGCTATTGATCATGGTTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGTCTGTGAGATCGTGGGAGGTTGTGACTGAAGAAAGAGTAGAAGCAG
TACTAAAAGAATTACACTATATTAAATGA
GTGTTAACATACGACGAGTTTAAGCAGGCTATTGATCATGGTTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGTCTGTGAGATCGTGGGAGGTTGTGACTGAAGAAAGAGTAGAAGCAG
TACTAAAAGAATTACACTATATTAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
80.645 |
100 |
0.806 |
| prx | Streptococcus pyogenes MGAS315 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS8232 |
81.034 |
93.548 |
0.758 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
95.161 |
0.71 |
| prx | Streptococcus pyogenes MGAS315 |
88.095 |
67.742 |
0.597 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
67.742 |
0.548 |