Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   V6U67_RS09185 Genome accession   NZ_CP145865
Coordinates   1982771..1983001 (-) Length   76 a.a.
NCBI ID   WP_002887015.1    Uniprot ID   -
Organism   Streptococcus salivarius strain KSS8     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1977771..1988001
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V6U67_RS09150 (V6U67_09155) - 1978161..1978607 (-) 447 WP_022496102.1 hypothetical protein -
  V6U67_RS09155 (V6U67_09160) - 1978685..1979341 (-) 657 WP_002885876.1 CPBP family intramembrane glutamic endopeptidase -
  V6U67_RS09160 (V6U67_09165) - 1979353..1979550 (-) 198 WP_002885716.1 helix-turn-helix transcriptional regulator -
  V6U67_RS09165 (V6U67_09170) - 1979801..1980994 (-) 1194 WP_002885831.1 acetate kinase -
  V6U67_RS09170 (V6U67_09175) comGH 1981051..1982007 (-) 957 WP_022496101.1 class I SAM-dependent methyltransferase Machinery gene
  V6U67_RS09175 (V6U67_09180) comGG 1982052..1982369 (-) 318 WP_021144683.1 competence type IV pilus minor pilin ComGG Machinery gene
  V6U67_RS09180 (V6U67_09185) comGF 1982347..1982784 (-) 438 WP_022496100.1 competence type IV pilus minor pilin ComGF Machinery gene
  V6U67_RS09185 (V6U67_09190) comGE 1982771..1983001 (-) 231 WP_002887015.1 competence type IV pilus minor pilin ComGE Machinery gene
  V6U67_RS09190 (V6U67_09195) comGD 1983033..1983461 (-) 429 WP_014632541.1 competence type IV pilus minor pilin ComGD Machinery gene
  V6U67_RS09195 (V6U67_09200) comGC 1983421..1983735 (-) 315 WP_037611125.1 competence type IV pilus major pilin ComGC Machinery gene
  V6U67_RS09200 (V6U67_09205) comGB 1983744..1984844 (-) 1101 WP_156024868.1 competence type IV pilus assembly protein ComGB Machinery gene
  V6U67_RS09205 (V6U67_09210) comGA 1984726..1985667 (-) 942 WP_022496097.1 competence type IV pilus ATPase ComGA Machinery gene
  V6U67_RS09210 (V6U67_09215) - 1985747..1986109 (-) 363 WP_002887019.1 DUF1033 family protein -

Sequence


Protein


Download         Length: 76 a.a.        Molecular weight: 8399.78 Da        Isoelectric Point: 10.0924

>NTDB_id=853779 V6U67_RS09185 WP_002887015.1 1982771..1983001(-) (comGE) [Streptococcus salivarius strain KSS8]
MAVLVLVSGLILDQINTNRRLMARNLHQQEVLSVATMAVQTKQDQLTLNGITVTVKRSQQGIAVYESGKEIIHVSQ

Nucleotide


Download         Length: 231 bp        

>NTDB_id=853779 V6U67_RS09185 WP_002887015.1 1982771..1983001(-) (comGE) [Streptococcus salivarius strain KSS8]
ATGGCTGTCTTAGTACTCGTCAGTGGTCTTATCTTGGATCAGATCAATACCAATCGTAGGCTAATGGCTAGGAATCTCCA
CCAACAGGAGGTCTTGAGTGTGGCAACCATGGCAGTTCAGACAAAACAGGATCAGTTGACCTTAAATGGGATCACAGTGA
CGGTAAAACGTAGCCAGCAAGGTATCGCGGTTTATGAATCAGGAAAGGAGATTATTCATGTCTCTCAATAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Streptococcus mutans UA140

39.189

97.368

0.382

  comGE Streptococcus mutans UA159

39.189

97.368

0.382