Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   V6U66_RS09925 Genome accession   NZ_CP145864
Coordinates   2109779..2110009 (-) Length   76 a.a.
NCBI ID   WP_013991265.1    Uniprot ID   -
Organism   Streptococcus salivarius strain KSS7     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2104779..2115009
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V6U66_RS09890 (V6U66_09870) - 2105169..2105615 (-) 447 WP_045001368.1 hypothetical protein -
  V6U66_RS09895 (V6U66_09875) - 2105693..2106349 (-) 657 WP_014632546.1 CPBP family intramembrane glutamic endopeptidase -
  V6U66_RS09900 (V6U66_09880) - 2106361..2106558 (-) 198 WP_002885716.1 helix-turn-helix transcriptional regulator -
  V6U66_RS09905 (V6U66_09885) - 2106809..2108002 (-) 1194 WP_002885831.1 acetate kinase -
  V6U66_RS09910 (V6U66_09890) comGH 2108059..2109015 (-) 957 WP_014632544.1 class I SAM-dependent methyltransferase Machinery gene
  V6U66_RS09915 (V6U66_09895) comGG 2109060..2109377 (-) 318 WP_045001363.1 competence type IV pilus minor pilin ComGG Machinery gene
  V6U66_RS09920 (V6U66_09900) comGF 2109355..2109792 (-) 438 WP_410534501.1 competence type IV pilus minor pilin ComGF Machinery gene
  V6U66_RS09925 (V6U66_09905) comGE 2109779..2110009 (-) 231 WP_013991265.1 competence type IV pilus minor pilin ComGE Machinery gene
  V6U66_RS09930 (V6U66_09910) comGD 2110041..2110469 (-) 429 WP_014632541.1 competence type IV pilus minor pilin ComGD Machinery gene
  V6U66_RS09935 (V6U66_09915) comGC 2110429..2110755 (-) 327 WP_070576715.1 competence type IV pilus major pilin ComGC Machinery gene
  V6U66_RS09940 (V6U66_09920) comGB 2110752..2111852 (-) 1101 WP_155214000.1 competence type IV pilus assembly protein ComGB Machinery gene
  V6U66_RS09945 (V6U66_09925) comGA 2111734..2112675 (-) 942 WP_155214001.1 competence type IV pilus ATPase ComGA Machinery gene
  V6U66_RS09950 (V6U66_09930) - 2112755..2113117 (-) 363 WP_002887019.1 DUF1033 family protein -

Sequence


Protein


Download         Length: 76 a.a.        Molecular weight: 8399.82 Da        Isoelectric Point: 10.4655

>NTDB_id=853666 V6U66_RS09925 WP_013991265.1 2109779..2110009(-) (comGE) [Streptococcus salivarius strain KSS7]
MAVLVLVSGLILDQINTNRRLMARNLHQQEVLSVATMAVQTKQDQLTLNGITVTVKRSKQGIAVYESGKEIIHVSQ

Nucleotide


Download         Length: 231 bp        

>NTDB_id=853666 V6U66_RS09925 WP_013991265.1 2109779..2110009(-) (comGE) [Streptococcus salivarius strain KSS7]
ATGGCTGTCTTAGTACTCGTCAGTGGTCTTATCTTGGATCAGATCAATACCAATCGTAGGCTAATGGCTAGGAATCTCCA
CCAACAGGAGGTTTTGAGTGTGGCAACCATGGCAGTTCAGACCAAACAGGATCAGTTGACCTTAAATGGCATCACAGTGA
CAGTAAAACGTAGCAAGCAAGGTATCGCGGTTTACGAATCAGGAAAGGAGATTATTCATGTCTCTCAATAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Streptococcus mutans UA140

37.838

97.368

0.368

  comGE Streptococcus mutans UA159

37.838

97.368

0.368