Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | LLD17_RS09625 | Genome accession | NZ_CP129182 |
| Coordinates | 1744098..1744523 (-) | Length | 141 a.a. |
| NCBI ID | WP_032950583.1 | Uniprot ID | - |
| Organism | Lactococcus cremoris strain D.1.7 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1711347..1751555 | 1744098..1744523 | within | 0 |
Gene organization within MGE regions
Location: 1711347..1751555
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLD17_RS09390 (LLD17_09425) | - | 1711347..1711652 (-) | 306 | WP_011834820.1 | bacteriocin immunity protein | - |
| LLD17_RS09395 (LLD17_09430) | - | 1711657..1711881 (-) | 225 | WP_021165549.1 | garvicin Q family class II bacteriocin | - |
| LLD17_RS09400 (LLD17_09435) | - | 1712096..1712986 (+) | 891 | WP_081196795.1 | IS982-like element IS982B family transposase | - |
| LLD17_RS09405 (LLD17_09440) | - | 1712968..1713168 (-) | 201 | WP_011676499.1 | hypothetical protein | - |
| LLD17_RS09415 (LLD17_09450) | - | 1714001..1714171 (-) | 171 | WP_167594928.1 | bacteriophage holin | - |
| LLD17_RS09420 (LLD17_09455) | - | 1714396..1715685 (-) | 1290 | WP_081196796.1 | LysM peptidoglycan-binding domain-containing protein | - |
| LLD17_RS09425 (LLD17_09460) | - | 1715682..1715948 (-) | 267 | WP_015966839.1 | phage holin | - |
| LLD17_RS09430 (LLD17_09465) | - | 1715973..1717925 (-) | 1953 | WP_101913739.1 | BppU family phage baseplate upper protein | - |
| LLD17_RS09435 (LLD17_09470) | - | 1717938..1718162 (-) | 225 | WP_061778129.1 | hemolysin XhlA family protein | - |
| LLD17_RS09440 (LLD17_09475) | - | 1718175..1718690 (-) | 516 | WP_081106886.1 | hypothetical protein | - |
| LLD17_RS09445 (LLD17_09480) | - | 1718709..1720049 (-) | 1341 | WP_101944611.1 | fibronectin type III domain-containing protein | - |
| LLD17_RS09450 (LLD17_09485) | - | 1720051..1721019 (-) | 969 | WP_098404855.1 | BppU family phage baseplate upper protein | - |
| LLD17_RS09455 (LLD17_09490) | - | 1721032..1723821 (-) | 2790 | WP_098404854.1 | phage tail spike protein | - |
| LLD17_RS09460 (LLD17_09495) | - | 1723821..1724582 (-) | 762 | WP_098404853.1 | distal tail protein Dit | - |
| LLD17_RS09465 (LLD17_09500) | - | 1724592..1726691 (-) | 2100 | WP_098404852.1 | tape measure protein | - |
| LLD17_RS09470 (LLD17_09505) | - | 1726707..1726976 (-) | 270 | WP_098404851.1 | hypothetical protein | - |
| LLD17_RS09475 (LLD17_09510) | - | 1727060..1727409 (-) | 350 | Protein_1707 | tail assembly chaperone | - |
| LLD17_RS09480 (LLD17_09515) | - | 1727525..1728034 (-) | 510 | WP_098404850.1 | phage major tail protein, TP901-1 family | - |
| LLD17_RS09485 (LLD17_09520) | - | 1728045..1728434 (-) | 390 | WP_014572187.1 | hypothetical protein | - |
| LLD17_RS09490 (LLD17_09525) | - | 1728431..1728757 (-) | 327 | WP_098404849.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| LLD17_RS09495 (LLD17_09530) | - | 1728754..1729065 (-) | 312 | WP_098404848.1 | hypothetical protein | - |
| LLD17_RS09500 (LLD17_09535) | - | 1729062..1729394 (-) | 333 | WP_021212689.1 | phage head-tail connector protein | - |
| LLD17_RS09505 (LLD17_09540) | - | 1729378..1729578 (-) | 201 | WP_011676051.1 | HeH/LEM domain-containing protein | - |
| LLD17_RS09510 (LLD17_09545) | - | 1729578..1730398 (-) | 821 | Protein_1714 | N4-gp56 family major capsid protein | - |
| LLD17_RS09515 (LLD17_09550) | - | 1730400..1731062 (-) | 663 | WP_101913591.1 | DUF4355 domain-containing protein | - |
| LLD17_RS09520 (LLD17_09555) | - | 1731247..1731594 (+) | 348 | WP_011676518.1 | hypothetical protein | - |
| LLD17_RS09525 (LLD17_09560) | - | 1731554..1731895 (-) | 342 | WP_011676519.1 | hypothetical protein | - |
| LLD17_RS09530 (LLD17_09565) | - | 1731892..1732941 (-) | 1050 | WP_098404846.1 | minor capsid protein | - |
| LLD17_RS09535 (LLD17_09570) | - | 1732945..1734321 (-) | 1377 | WP_098404845.1 | phage portal protein | - |
| LLD17_RS09540 (LLD17_09575) | terL | 1734336..1735723 (-) | 1388 | Protein_1720 | phage terminase large subunit | - |
| LLD17_RS09545 (LLD17_09580) | - | 1735716..1736126 (-) | 411 | WP_011676523.1 | terminase | - |
| LLD17_RS09550 (LLD17_09585) | - | 1736299..1736835 (-) | 537 | WP_143466250.1 | hypothetical protein | - |
| LLD17_RS09555 (LLD17_09590) | - | 1737083..1737508 (-) | 426 | WP_058203511.1 | RinA family protein | - |
| LLD17_RS09560 (LLD17_09595) | - | 1737755..1738219 (-) | 465 | WP_098404842.1 | hypothetical protein | - |
| LLD17_RS09565 (LLD17_09600) | - | 1738352..1738645 (-) | 294 | WP_011676526.1 | DUF1359 domain-containing protein | - |
| LLD17_RS09570 (LLD17_09605) | dut | 1738935..1739354 (-) | 420 | WP_061777709.1 | dUTP diphosphatase | - |
| LLD17_RS09575 (LLD17_09610) | - | 1739351..1739662 (-) | 312 | WP_098404841.1 | hypothetical protein | - |
| LLD17_RS09580 (LLD17_09615) | - | 1739659..1740222 (-) | 564 | WP_098404840.1 | DUF1642 domain-containing protein | - |
| LLD17_RS09585 (LLD17_09620) | - | 1740215..1740421 (-) | 207 | WP_011676933.1 | DUF1125 domain-containing protein | - |
| LLD17_RS09590 (LLD17_09625) | - | 1740418..1740807 (-) | 390 | WP_032950595.1 | YopX family protein | - |
| LLD17_RS09595 (LLD17_09630) | - | 1740779..1741120 (-) | 342 | WP_058212883.1 | hypothetical protein | - |
| LLD17_RS09600 (LLD17_09635) | - | 1741502..1741681 (-) | 180 | WP_021165553.1 | DUF1031 family protein | - |
| LLD17_RS09605 (LLD17_09640) | - | 1741682..1742101 (-) | 420 | WP_021165554.1 | hypothetical protein | - |
| LLD17_RS09610 (LLD17_09645) | - | 1742091..1742255 (-) | 165 | WP_098404839.1 | hypothetical protein | - |
| LLD17_RS09615 (LLD17_09650) | - | 1742453..1743154 (-) | 702 | WP_257141475.1 | ATP-binding protein | - |
| LLD17_RS09620 (LLD17_09655) | - | 1743164..1743970 (-) | 807 | WP_098404838.1 | phage replisome organizer N-terminal domain-containing protein | - |
| LLD17_RS09625 (LLD17_09660) | ssb | 1744098..1744523 (-) | 426 | WP_032950583.1 | single-stranded DNA-binding protein | Machinery gene |
| LLD17_RS09630 (LLD17_09665) | - | 1744516..1745274 (-) | 759 | WP_061777716.1 | Rad52/Rad22 family DNA repair protein | - |
| LLD17_RS09635 (LLD17_09670) | - | 1745283..1745681 (-) | 399 | WP_098404837.1 | hypothetical protein | - |
| LLD17_RS09640 (LLD17_09675) | - | 1745866..1746015 (-) | 150 | WP_257141473.1 | DUF1408 domain-containing protein | - |
| LLD17_RS09645 (LLD17_09680) | - | 1746118..1746396 (+) | 279 | WP_011834777.1 | hypothetical protein | - |
| LLD17_RS09650 (LLD17_09685) | - | 1746351..1746584 (-) | 234 | WP_011834776.1 | hypothetical protein | - |
| LLD17_RS09655 (LLD17_09690) | - | 1746738..1746974 (-) | 237 | WP_011834775.1 | helix-turn-helix domain-containing protein | - |
| LLD17_RS09660 (LLD17_09695) | - | 1746987..1747712 (-) | 726 | Protein_1744 | ORF6C domain-containing protein | - |
| LLD17_RS09665 (LLD17_09700) | - | 1747726..1747965 (-) | 240 | WP_098404836.1 | helix-turn-helix transcriptional regulator | - |
| LLD17_RS09670 (LLD17_09705) | - | 1748306..1748509 (-) | 204 | WP_021165564.1 | putative transcriptional regulator | - |
| LLD17_RS09675 (LLD17_09710) | - | 1748772..1749584 (+) | 813 | WP_021165565.1 | S24 family peptidase | - |
| LLD17_RS09680 (LLD17_09715) | - | 1749634..1750767 (+) | 1134 | WP_021165566.1 | site-specific integrase | - |
| LLD17_RS09685 (LLD17_09720) | - | 1750875..1751555 (-) | 681 | WP_011834934.1 | IS6-like element IS1216 family transposase | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15656.42 Da Isoelectric Point: 5.1972
>NTDB_id=851391 LLD17_RS09625 WP_032950583.1 1744098..1744523(-) (ssb) [Lactococcus cremoris strain D.1.7]
MINNVILVGRITKEPELRYTPQNKAVAAFTLAVNRAFKNANGEREADFINCVIWGKSAENLANWTHKGQLIGVTGSIQTR
NYENQQGQRVYITEVVASNFQVLEKSNQANGERVSNPAAKPQNNDSFGSDPMEISDDDLPF
MINNVILVGRITKEPELRYTPQNKAVAAFTLAVNRAFKNANGEREADFINCVIWGKSAENLANWTHKGQLIGVTGSIQTR
NYENQQGQRVYITEVVASNFQVLEKSNQANGERVSNPAAKPQNNDSFGSDPMEISDDDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=851391 LLD17_RS09625 WP_032950583.1 1744098..1744523(-) (ssb) [Lactococcus cremoris strain D.1.7]
ATGATTAACAATGTCATTCTAGTAGGGCGAATCACTAAAGAACCTGAACTTAGATATACACCACAAAATAAAGCAGTTGC
CGCTTTTACTCTTGCAGTTAATCGAGCATTTAAAAACGCTAATGGAGAAAGAGAAGCTGACTTTATCAATTGTGTTATTT
GGGGTAAATCAGCCGAAAACTTGGCCAATTGGACTCATAAAGGTCAATTAATTGGAGTTACTGGTAGTATTCAAACTCGC
AACTATGAGAATCAACAAGGGCAACGGGTTTATATTACGGAGGTTGTCGCAAGTAATTTCCAAGTACTAGAAAAAAGTAA
TCAAGCAAATGGTGAACGAGTTAGTAATCCAGCTGCAAAACCACAAAATAACGATTCTTTTGGAAGTGATCCAATGGAAA
TTTCAGATGATGACCTACCATTCTAA
ATGATTAACAATGTCATTCTAGTAGGGCGAATCACTAAAGAACCTGAACTTAGATATACACCACAAAATAAAGCAGTTGC
CGCTTTTACTCTTGCAGTTAATCGAGCATTTAAAAACGCTAATGGAGAAAGAGAAGCTGACTTTATCAATTGTGTTATTT
GGGGTAAATCAGCCGAAAACTTGGCCAATTGGACTCATAAAGGTCAATTAATTGGAGTTACTGGTAGTATTCAAACTCGC
AACTATGAGAATCAACAAGGGCAACGGGTTTATATTACGGAGGTTGTCGCAAGTAATTTCCAAGTACTAGAAAAAAGTAA
TCAAGCAAATGGTGAACGAGTTAGTAATCCAGCTGCAAAACCACAAAATAACGATTCTTTTGGAAGTGATCCAATGGAAA
TTTCAGATGATGACCTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
53.529 |
100 |
0.645 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
51.744 |
100 |
0.631 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
44.681 |
100 |
0.447 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
44.681 |
100 |
0.447 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
44.681 |
100 |
0.447 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
43.972 |
100 |
0.44 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
43.972 |
100 |
0.44 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
43.972 |
100 |
0.44 |
| ssbB/cilA | Streptococcus mitis SK321 |
43.972 |
100 |
0.44 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
57.692 |
73.759 |
0.426 |
| ssbA | Streptococcus mutans UA159 |
40.426 |
100 |
0.404 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
50.485 |
73.05 |
0.369 |
| ssb | Vibrio cholerae strain A1552 |
29.651 |
100 |
0.362 |