Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | V2176_RS15295 | Genome accession | NZ_CP143963 |
| Coordinates | 2901325..2901465 (-) | Length | 46 a.a. |
| NCBI ID | WP_003184860.1 | Uniprot ID | A0ABM6LMF9 |
| Organism | Bacillus licheniformis strain FUA2151 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2896325..2906465
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| V2176_RS15270 (V2176_15270) | - | 2896596..2896985 (-) | 390 | WP_003184847.1 | hotdog fold thioesterase | - |
| V2176_RS15275 (V2176_15275) | comA | 2897002..2897640 (-) | 639 | WP_003184849.1 | response regulator transcription factor | Regulator |
| V2176_RS15280 (V2176_15280) | comP | 2897727..2900048 (-) | 2322 | WP_330937911.1 | ATP-binding protein | Regulator |
| V2176_RS15285 (V2176_15285) | comX | 2900088..2900252 (-) | 165 | WP_011198251.1 | competence pheromone ComX | - |
| V2176_RS15290 (V2176_15290) | comQ | 2900267..2901136 (-) | 870 | WP_330937912.1 | polyprenyl synthetase family protein | Regulator |
| V2176_RS15295 (V2176_15295) | degQ | 2901325..2901465 (-) | 141 | WP_003184860.1 | degradation enzyme regulation protein DegQ | Regulator |
| V2176_RS15300 (V2176_15300) | - | 2901951..2902298 (+) | 348 | WP_009329512.1 | hypothetical protein | - |
| V2176_RS15305 (V2176_15305) | - | 2902341..2903561 (-) | 1221 | WP_330937913.1 | EAL and HDOD domain-containing protein | - |
| V2176_RS15310 (V2176_15310) | - | 2903740..2905149 (-) | 1410 | WP_228767691.1 | nicotinate phosphoribosyltransferase | - |
| V2176_RS15315 (V2176_15315) | - | 2905227..2905778 (-) | 552 | WP_003184868.1 | cysteine hydrolase family protein | - |
| V2176_RS15320 (V2176_15320) | - | 2905963..2906364 (-) | 402 | WP_330937914.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5747.56 Da Isoelectric Point: 8.4596
>NTDB_id=845772 V2176_RS15295 WP_003184860.1 2901325..2901465(-) (degQ) [Bacillus licheniformis strain FUA2151]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS
Nucleotide
Download Length: 141 bp
>NTDB_id=845772 V2176_RS15295 WP_003184860.1 2901325..2901465(-) (degQ) [Bacillus licheniformis strain FUA2151]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
71.429 |
91.304 |
0.652 |