Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   VKP56_RS00670 Genome accession   NZ_CP142350
Coordinates   104720..105004 (+) Length   94 a.a.
NCBI ID   WP_265415305.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain SS1445     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 99720..110004
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VKP56_RS00645 (VKP56_00645) - 101666..102031 (+) 366 WP_002986560.1 DUF1033 family protein -
  VKP56_RS00650 (VKP56_00650) comGA 102124..103062 (+) 939 WP_326657116.1 competence type IV pilus ATPase ComGA Machinery gene
  VKP56_RS00655 (VKP56_00655) comGB 102998..104032 (+) 1035 WP_011054115.1 competence type IV pilus assembly protein ComGB Machinery gene
  VKP56_RS00660 (VKP56_00660) comGC 104034..104360 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  VKP56_RS00665 (VKP56_00665) comGD 104335..104763 (+) 429 WP_002986548.1 competence type IV pilus minor pilin ComGD Machinery gene
  VKP56_RS00670 (VKP56_00670) comGE 104720..105004 (+) 285 WP_265415305.1 competence type IV pilus minor pilin ComGE Machinery gene
  VKP56_RS00675 (VKP56_00675) comGF 104997..105431 (+) 435 WP_326657121.1 competence type IV pilus minor pilin ComGF Machinery gene
  VKP56_RS00680 (VKP56_00680) comGG 105415..105741 (+) 327 WP_010921801.1 competence type IV pilus minor pilin ComGG -
  VKP56_RS00685 (VKP56_00685) comGH 105839..106792 (+) 954 WP_010921802.1 class I SAM-dependent methyltransferase Machinery gene
  VKP56_RS00690 (VKP56_00690) - 106851..108047 (+) 1197 WP_011284424.1 acetate kinase -
  VKP56_RS00695 (VKP56_00695) - 108234..108542 (+) 309 WP_030126458.1 hypothetical protein -
  VKP56_RS00700 (VKP56_00700) proC 108625..109395 (-) 771 WP_014407219.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10642.54 Da        Isoelectric Point: 8.9043

>NTDB_id=840091 VKP56_RS00670 WP_265415305.1 104720..105004(+) (comGE) [Streptococcus pyogenes strain SS1445]
MGIIKKQVKAYIALESMIATGTLFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEITLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=840091 VKP56_RS00670 WP_265415305.1 104720..105004(+) (comGE) [Streptococcus pyogenes strain SS1445]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATCGCAACAGGCACCCTCTTTAGTATTGT
CATTCTTGTCTTAAGTAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATAACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383