Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | R8559_RS02880 | Genome accession | NZ_AP026926 |
| Coordinates | 540660..540809 (+) | Length | 49 a.a. |
| NCBI ID | WP_001820573.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain PZ900700119 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 535660..545809
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| R8559_RS02830 (PC0116_05570) | comA/nlmT | 535700..536287 (-) | 588 | WP_000205166.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| R8559_RS02835 (PC0116_05580) | blpI | 536569..536766 (+) | 198 | WP_001093261.1 | bacteriocin-like peptide BlpI | - |
| R8559_RS02840 (PC0116_05600) | blpJ | 537233..537502 (+) | 270 | WP_001093248.1 | bacteriocin-like peptide BlpJ | - |
| R8559_RS02845 (PC0116_05610) | blpU | 537571..537801 (+) | 231 | WP_000379967.1 | bacteriocin-like peptide BlpU | - |
| R8559_RS02850 | - | 537804..537923 (+) | 120 | WP_000346298.1 | PncF family bacteriocin immunity protein | - |
| R8559_RS02855 (PC0116_05620) | - | 538220..538384 (+) | 165 | WP_000727118.1 | hypothetical protein | - |
| R8559_RS02860 (PC0116_05630) | - | 538381..538785 (+) | 405 | WP_000846944.1 | hypothetical protein | - |
| R8559_RS02865 | - | 538988..539793 (+) | 806 | Protein_564 | IS5 family transposase | - |
| R8559_RS02870 (PC0116_05660) | blpM | 539943..540197 (+) | 255 | WP_000379877.1 | two-peptide bacteriocin subunit BlpM | - |
| R8559_RS02875 (PC0116_05670) | blpN | 540213..540416 (+) | 204 | WP_001099492.1 | two-peptide bacteriocin subunit BlpN | - |
| R8559_RS02880 (PC0116_05680) | cipB | 540660..540809 (+) | 150 | WP_001820573.1 | bacteriocin-like peptide BlpO | Regulator |
| R8559_RS02885 | - | 540913..541032 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| R8559_RS02890 (PC0116_05700) | - | 541818..542201 (+) | 384 | WP_000877381.1 | hypothetical protein | - |
| R8559_RS02895 (PC0116_05710) | - | 542253..542942 (+) | 690 | WP_000760510.1 | CPBP family intramembrane glutamic endopeptidase | - |
| R8559_RS02900 (PC0116_05720) | blpZ | 542984..543217 (+) | 234 | WP_001818347.1 | immunity protein BlpZ | - |
| R8559_RS02905 | - | 543368..543979 (+) | 612 | WP_000394049.1 | CPBP family intramembrane glutamic endopeptidase | - |
| R8559_RS02910 (PC0116_05730) | ccrZ | 544140..544934 (+) | 795 | WP_000363002.1 | cell cycle regulator CcrZ | - |
| R8559_RS02915 (PC0116_05740) | trmB | 544931..545566 (+) | 636 | WP_001266083.1 | tRNA (guanosine(46)-N7)-methyltransferase TrmB | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5150.91 Da Isoelectric Point: 3.9133
>NTDB_id=82777 R8559_RS02880 WP_001820573.1 540660..540809(+) (cipB) [Streptococcus pneumoniae strain PZ900700119]
MDTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MDTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=82777 R8559_RS02880 WP_001820573.1 540660..540809(+) (cipB) [Streptococcus pneumoniae strain PZ900700119]
ATGGATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGGATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
51.02 |
100 |
0.51 |