Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   SC043_RS10950 Genome accession   NZ_CP138309
Coordinates   2157002..2157286 (-) Length   94 a.a.
NCBI ID   WP_010906314.1    Uniprot ID   Q9CDU4
Organism   Lactococcus lactis strain B26     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2152002..2162286
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SC043_RS10920 (SC043_10920) - 2152442..2152819 (-) 378 WP_003129983.1 pyridoxamine 5'-phosphate oxidase family protein -
  SC043_RS10925 (SC043_10925) - 2153024..2153890 (+) 867 WP_010906309.1 RluA family pseudouridine synthase -
  SC043_RS10930 (SC043_10930) - 2153929..2154738 (-) 810 WP_010906310.1 metal ABC transporter permease -
  SC043_RS10935 (SC043_10935) - 2154731..2155468 (-) 738 WP_010906311.1 metal ABC transporter ATP-binding protein -
  SC043_RS10940 (SC043_10940) - 2155645..2156487 (-) 843 WP_010906312.1 metal ABC transporter substrate-binding protein -
  SC043_RS10945 (SC043_10945) - 2156484..2156921 (-) 438 WP_010906313.1 zinc-dependent MarR family transcriptional regulator -
  SC043_RS10950 (SC043_10950) comGG 2157002..2157286 (-) 285 WP_010906314.1 competence type IV pilus minor pilin ComGG Machinery gene
  SC043_RS10955 (SC043_10955) comGF 2157325..2157771 (-) 447 WP_031296844.1 competence type IV pilus minor pilin ComGF Machinery gene
  SC043_RS10960 (SC043_10960) comGE 2157734..2158030 (-) 297 WP_010906316.1 competence type IV pilus minor pilin ComGE Machinery gene
  SC043_RS10965 (SC043_10965) comGD 2158002..2158418 (-) 417 WP_021216554.1 competence type IV pilus minor pilin ComGD Machinery gene
  SC043_RS10970 (SC043_10970) comGC 2158393..2158677 (-) 285 WP_032941550.1 competence type IV pilus major pilin ComGC Machinery gene
  SC043_RS10975 (SC043_10975) - 2158809..2159333 (-) 525 WP_014570795.1 GNAT family N-acetyltransferase -
  SC043_RS10980 (SC043_10980) - 2159412..2160191 (-) 780 WP_058147788.1 peptidoglycan amidohydrolase family protein -
  SC043_RS10985 (SC043_10985) - 2160191..2160490 (-) 300 WP_031559226.1 phage holin -
  SC043_RS10990 (SC043_10990) - 2160503..2160853 (-) 351 WP_023349296.1 hypothetical protein -
  SC043_RS13085 - 2160873..2161718 (-) 846 Protein_2141 hypothetical protein -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10783.02 Da        Isoelectric Point: 5.0604

>NTDB_id=824562 SC043_RS10950 WP_010906314.1 2157002..2157286(-) (comGG) [Lactococcus lactis strain B26]
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDEKTYQF
SIHLKDGANFQIKN

Nucleotide


Download         Length: 285 bp        

>NTDB_id=824562 SC043_RS10950 WP_010906314.1 2157002..2157286(-) (comGG) [Lactococcus lactis strain B26]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAAAACTTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q9CDU4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

59.14

98.936

0.585