Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | P3T88_RS04855 | Genome accession | NZ_CP120200 |
| Coordinates | 1038561..1039010 (+) | Length | 149 a.a. |
| NCBI ID | WP_131112717.1 | Uniprot ID | - |
| Organism | Staphylococcus pseudintermedius strain Dog003 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1018414..1072977 | 1038561..1039010 | within | 0 |
Gene organization within MGE regions
Location: 1018414..1072977
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P3T88_RS04690 (P3T88_04690) | ecsB | 1018414..1019628 (+) | 1215 | WP_015729358.1 | ABC transporter permease EcsB | - |
| P3T88_RS04695 (P3T88_04695) | ltrA | 1020172..1021458 (+) | 1287 | WP_199641485.1 | group II intron reverse transcriptase/maturase | - |
| P3T88_RS04700 (P3T88_04700) | - | 1021526..1022038 (-) | 513 | WP_075773705.1 | signal transduction protein TRAP | - |
| P3T88_RS04705 (P3T88_04705) | hemE | 1022351..1023385 (+) | 1035 | WP_014613558.1 | uroporphyrinogen decarboxylase | - |
| P3T88_RS04710 (P3T88_04710) | hemH | 1023423..1024355 (+) | 933 | WP_014613559.1 | ferrochelatase | - |
| P3T88_RS04715 (P3T88_04715) | hemY | 1024361..1025755 (+) | 1395 | WP_203160788.1 | protoporphyrinogen oxidase | - |
| P3T88_RS04720 (P3T88_04720) | - | 1026022..1026576 (+) | 555 | WP_015729355.1 | RBBP9/YdeN family alpha/beta hydrolase | - |
| P3T88_RS04770 (P3T88_04770) | - | 1027881..1028927 (-) | 1047 | WP_065520443.1 | tyrosine-type recombinase/integrase | - |
| P3T88_RS04775 (P3T88_04775) | - | 1028990..1030309 (-) | 1320 | WP_131112723.1 | DUF4041 domain-containing protein | - |
| P3T88_RS04780 (P3T88_04780) | - | 1030353..1030805 (-) | 453 | WP_131112722.1 | ImmA/IrrE family metallo-endopeptidase | - |
| P3T88_RS04785 (P3T88_04785) | - | 1030819..1031151 (-) | 333 | WP_096548971.1 | helix-turn-helix domain-containing protein | - |
| P3T88_RS04790 (P3T88_04790) | - | 1031344..1031583 (+) | 240 | WP_096548970.1 | helix-turn-helix domain-containing protein | - |
| P3T88_RS04795 (P3T88_04795) | - | 1031600..1031842 (+) | 243 | WP_100002386.1 | hypothetical protein | - |
| P3T88_RS04800 (P3T88_04800) | - | 1031799..1032299 (-) | 501 | WP_096533155.1 | hypothetical protein | - |
| P3T88_RS04805 (P3T88_04805) | - | 1032356..1033132 (+) | 777 | WP_100006865.1 | phage antirepressor | - |
| P3T88_RS04810 (P3T88_04810) | - | 1033263..1033430 (+) | 168 | WP_165443333.1 | hypothetical protein | - |
| P3T88_RS04815 (P3T88_04815) | - | 1033427..1033654 (-) | 228 | WP_096548968.1 | hypothetical protein | - |
| P3T88_RS04820 (P3T88_04820) | - | 1033724..1033933 (+) | 210 | WP_100006864.1 | hypothetical protein | - |
| P3T88_RS04825 (P3T88_04825) | - | 1033948..1034124 (+) | 177 | WP_165479882.1 | hypothetical protein | - |
| P3T88_RS04830 (P3T88_04830) | - | 1034126..1034440 (+) | 315 | WP_131112721.1 | DUF2482 family protein | - |
| P3T88_RS04835 (P3T88_04835) | - | 1034520..1034777 (+) | 258 | WP_323696350.1 | DUF1108 family protein | - |
| P3T88_RS04840 (P3T88_04840) | - | 1034793..1036739 (+) | 1947 | WP_131112720.1 | AAA family ATPase | - |
| P3T88_RS12670 | - | 1036778..1036933 (+) | 156 | WP_410254262.1 | helix-turn-helix domain-containing protein | - |
| P3T88_RS04845 (P3T88_04845) | - | 1036947..1037861 (+) | 915 | WP_131112719.1 | RecT family recombinase | - |
| P3T88_RS04850 (P3T88_04850) | - | 1037924..1038568 (+) | 645 | WP_222936269.1 | MBL fold metallo-hydrolase | - |
| P3T88_RS04855 (P3T88_04855) | ssbA | 1038561..1039010 (+) | 450 | WP_131112717.1 | single-stranded DNA-binding protein | Machinery gene |
| P3T88_RS04860 (P3T88_04860) | - | 1039017..1039805 (+) | 789 | WP_131112716.1 | DnaD domain-containing protein | - |
| P3T88_RS04865 (P3T88_04865) | - | 1039820..1040602 (+) | 783 | WP_131112715.1 | ATP-binding protein | - |
| P3T88_RS04870 (P3T88_04870) | - | 1040766..1040972 (+) | 207 | WP_110148354.1 | hypothetical protein | - |
| P3T88_RS04875 (P3T88_04875) | - | 1041119..1041370 (+) | 252 | WP_131112714.1 | hypothetical protein | - |
| P3T88_RS04880 (P3T88_04880) | - | 1041403..1041597 (+) | 195 | WP_051144748.1 | SAV1978 family virulence-associated passenger protein | - |
| P3T88_RS04885 (P3T88_04885) | - | 1041603..1041815 (+) | 213 | WP_131091369.1 | hypothetical protein | - |
| P3T88_RS04890 (P3T88_04890) | - | 1042004..1042366 (+) | 363 | WP_131112713.1 | hypothetical protein | - |
| P3T88_RS04895 (P3T88_04895) | - | 1042367..1042594 (+) | 228 | WP_096636851.1 | hypothetical protein | - |
| P3T88_RS04900 (P3T88_04900) | - | 1042587..1043075 (+) | 489 | WP_096636850.1 | dUTP diphosphatase | - |
| P3T88_RS04905 (P3T88_04905) | - | 1043112..1043576 (+) | 465 | WP_129948902.1 | class I SAM-dependent methyltransferase | - |
| P3T88_RS04910 (P3T88_04910) | - | 1043573..1043761 (+) | 189 | WP_037542749.1 | DUF1381 domain-containing protein | - |
| P3T88_RS04915 (P3T88_04915) | rinB | 1043777..1043944 (+) | 168 | WP_129948901.1 | transcriptional activator RinB | - |
| P3T88_RS04920 (P3T88_04920) | - | 1043941..1044360 (+) | 420 | WP_131112712.1 | transcriptional regulator | - |
| P3T88_RS04925 (P3T88_04925) | - | 1044585..1045025 (+) | 441 | WP_131112711.1 | terminase small subunit | - |
| P3T88_RS04930 (P3T88_04930) | - | 1045018..1046268 (+) | 1251 | WP_131112710.1 | PBSX family phage terminase large subunit | - |
| P3T88_RS04935 (P3T88_04935) | - | 1046278..1047690 (+) | 1413 | WP_187470844.1 | phage portal protein | - |
| P3T88_RS04940 (P3T88_04940) | - | 1047674..1049224 (+) | 1551 | WP_187470843.1 | minor capsid protein | - |
| P3T88_RS04945 (P3T88_04945) | - | 1049229..1049360 (+) | 132 | WP_257975668.1 | hypothetical protein | - |
| P3T88_RS04950 (P3T88_04950) | - | 1049544..1050128 (+) | 585 | WP_131112707.1 | DUF4355 domain-containing protein | - |
| P3T88_RS04955 (P3T88_04955) | - | 1050143..1051090 (+) | 948 | WP_233519697.1 | sugar-binding protein | - |
| P3T88_RS04960 (P3T88_04960) | - | 1051110..1051433 (+) | 324 | WP_020219859.1 | phage head-tail connector protein | - |
| P3T88_RS04965 (P3T88_04965) | - | 1051430..1051753 (+) | 324 | WP_140239526.1 | hypothetical protein | - |
| P3T88_RS04970 (P3T88_04970) | - | 1051731..1052081 (+) | 351 | WP_233519698.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| P3T88_RS04975 (P3T88_04975) | - | 1052090..1052476 (+) | 387 | WP_100006821.1 | hypothetical protein | - |
| P3T88_RS04980 (P3T88_04980) | - | 1052494..1053042 (+) | 549 | WP_165479880.1 | phage tail tube protein | - |
| P3T88_RS04985 (P3T88_04985) | - | 1053096..1053449 (+) | 354 | WP_131112703.1 | tail assembly chaperone | - |
| P3T88_RS04990 (P3T88_04990) | - | 1053560..1053865 (+) | 306 | WP_233509769.1 | hypothetical protein | - |
| P3T88_RS04995 (P3T88_04995) | - | 1053878..1056721 (+) | 2844 | WP_187470842.1 | phage tail protein | - |
| P3T88_RS05000 (P3T88_05000) | - | 1056734..1057654 (+) | 921 | WP_187470841.1 | phage tail domain-containing protein | - |
| P3T88_RS05005 (P3T88_05005) | - | 1057669..1059084 (+) | 1416 | WP_131112700.1 | phage tail protein | - |
| P3T88_RS05010 (P3T88_05010) | - | 1059087..1059728 (+) | 642 | WP_037543732.1 | hypothetical protein | - |
| P3T88_RS05015 (P3T88_05015) | - | 1059739..1060737 (+) | 999 | WP_099994940.1 | SGNH/GDSL hydrolase family protein | - |
| P3T88_RS05020 (P3T88_05020) | - | 1060756..1062036 (+) | 1281 | WP_131112699.1 | phage baseplate upper protein | - |
| P3T88_RS05025 (P3T88_05025) | - | 1062084..1063589 (+) | 1506 | WP_131112698.1 | hypothetical protein | - |
| P3T88_RS05030 (P3T88_05030) | - | 1063601..1064035 (+) | 435 | WP_101457826.1 | holin family protein | - |
| P3T88_RS05035 (P3T88_05035) | - | 1064051..1064998 (+) | 948 | WP_131112697.1 | N-acetylmuramoyl-L-alanine amidase family protein | - |
| P3T88_RS05040 (P3T88_05040) | - | 1065253..1066182 (+) | 930 | WP_131112696.1 | DUF6731 family protein | - |
| P3T88_RS05045 (P3T88_05045) | - | 1066204..1066656 (+) | 453 | WP_131112695.1 | hypothetical protein | - |
| P3T88_RS05050 (P3T88_05050) | - | 1067135..1067332 (+) | 198 | WP_101457754.1 | hypothetical protein | - |
| P3T88_RS05055 (P3T88_05055) | - | 1068110..1068214 (+) | 105 | WP_181144027.1 | putative holin-like toxin | - |
| P3T88_RS05060 (P3T88_05060) | - | 1068587..1069981 (+) | 1395 | WP_105503200.1 | minor capsid protein | - |
| P3T88_RS05065 (P3T88_05065) | - | 1069993..1070235 (+) | 243 | WP_020219638.1 | hypothetical protein | - |
| P3T88_RS05070 (P3T88_05070) | - | 1070420..1071004 (+) | 585 | WP_096636530.1 | DUF4355 domain-containing protein | - |
| P3T88_RS05075 (P3T88_05075) | - | 1071063..1072043 (-) | 981 | WP_014613567.1 | leukocidin/hemolysin toxin family protein | - |
| P3T88_RS05080 (P3T88_05080) | - | 1072045..1072977 (-) | 933 | WP_014613568.1 | leukocidin/hemolysin toxin family protein | - |
Sequence
Protein
Download Length: 149 a.a. Molecular weight: 16607.59 Da Isoelectric Point: 8.4781
>NTDB_id=804610 P3T88_RS04855 WP_131112717.1 1038561..1039010(+) (ssbA) [Staphylococcus pseudintermedius strain Dog003]
MINRVVLVGRLTKNPELRHTPNGIIVSSFTLAVNRTFTNAKGEREADFINCIAFKKTAENINNYLSKGSLAGVDGRLKSR
SYENKEGQRIYVTEVICDSVQFLEPKNTSQKQDGYTRGQNQSKQTQSEPSGHPLFANGPIDISDDDLPF
MINRVVLVGRLTKNPELRHTPNGIIVSSFTLAVNRTFTNAKGEREADFINCIAFKKTAENINNYLSKGSLAGVDGRLKSR
SYENKEGQRIYVTEVICDSVQFLEPKNTSQKQDGYTRGQNQSKQTQSEPSGHPLFANGPIDISDDDLPF
Nucleotide
Download Length: 450 bp
>NTDB_id=804610 P3T88_RS04855 WP_131112717.1 1038561..1039010(+) (ssbA) [Staphylococcus pseudintermedius strain Dog003]
ATGATTAATAGAGTTGTACTTGTAGGTCGATTAACTAAAAATCCTGAATTAAGACATACACCAAATGGAATAATTGTTAG
CAGTTTCACACTCGCTGTAAATCGTACATTTACGAATGCAAAAGGTGAACGTGAAGCAGATTTTATTAACTGTATTGCCT
TTAAAAAAACAGCAGAGAACATTAATAACTACTTATCAAAAGGAAGTTTAGCAGGTGTTGATGGTCGTTTAAAATCACGC
AGTTACGAAAACAAAGAGGGACAACGCATATATGTCACTGAGGTGATATGTGACAGTGTTCAGTTTTTAGAACCTAAAAA
TACTAGTCAAAAACAAGACGGTTATACAAGAGGGCAAAATCAATCAAAACAAACACAGTCAGAACCAAGTGGACACCCCC
TTTTTGCAAATGGTCCGATTGATATAAGTGATGATGATTTACCTTTCTAA
ATGATTAATAGAGTTGTACTTGTAGGTCGATTAACTAAAAATCCTGAATTAAGACATACACCAAATGGAATAATTGTTAG
CAGTTTCACACTCGCTGTAAATCGTACATTTACGAATGCAAAAGGTGAACGTGAAGCAGATTTTATTAACTGTATTGCCT
TTAAAAAAACAGCAGAGAACATTAATAACTACTTATCAAAAGGAAGTTTAGCAGGTGTTGATGGTCGTTTAAAATCACGC
AGTTACGAAAACAAAGAGGGACAACGCATATATGTCACTGAGGTGATATGTGACAGTGTTCAGTTTTTAGAACCTAAAAA
TACTAGTCAAAAACAAGACGGTTATACAAGAGGGCAAAATCAATCAAAACAAACACAGTCAGAACCAAGTGGACACCCCC
TTTTTGCAAATGGTCCGATTGATATAAGTGATGATGATTTACCTTTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
56.977 |
100 |
0.658 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.584 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
56.637 |
75.839 |
0.43 |
| ssbA | Streptococcus mutans UA159 |
38.926 |
100 |
0.389 |