Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | P3U34_RS05425 | Genome accession | NZ_CP120106 |
| Coordinates | 1062689..1063180 (+) | Length | 163 a.a. |
| NCBI ID | WP_323706570.1 | Uniprot ID | - |
| Organism | Mammaliicoccus sciuri strain Dog108 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1052405..1095504 | 1062689..1063180 | within | 0 |
Gene organization within MGE regions
Location: 1052405..1095504
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P3U34_RS05340 (P3U34_05340) | - | 1052405..1053487 (-) | 1083 | WP_049320900.1 | tyrosine-type recombinase/integrase | - |
| P3U34_RS05345 (P3U34_05345) | - | 1053508..1053975 (-) | 468 | WP_227532220.1 | ImmA/IrrE family metallo-endopeptidase | - |
| P3U34_RS05350 (P3U34_05350) | - | 1054064..1055161 (-) | 1098 | WP_323706562.1 | hypothetical protein | - |
| P3U34_RS05355 (P3U34_05355) | - | 1055216..1055527 (-) | 312 | WP_323706563.1 | hypothetical protein | - |
| P3U34_RS05360 (P3U34_05360) | - | 1055626..1055988 (-) | 363 | WP_323706564.1 | helix-turn-helix transcriptional regulator | - |
| P3U34_RS05365 (P3U34_05365) | - | 1056141..1056353 (+) | 213 | WP_323706565.1 | helix-turn-helix transcriptional regulator | - |
| P3U34_RS05370 (P3U34_05370) | - | 1056454..1056765 (+) | 312 | WP_323706566.1 | DUF771 domain-containing protein | - |
| P3U34_RS05375 (P3U34_05375) | - | 1056782..1057498 (+) | 717 | WP_323706567.1 | ORF6C domain-containing protein | - |
| P3U34_RS05380 (P3U34_05380) | - | 1057692..1058195 (+) | 504 | WP_119493605.1 | hypothetical protein | - |
| P3U34_RS05385 (P3U34_05385) | - | 1058206..1058379 (+) | 174 | WP_158087710.1 | hypothetical protein | - |
| P3U34_RS05390 (P3U34_05390) | - | 1058393..1058677 (+) | 285 | WP_070373195.1 | hypothetical protein | - |
| P3U34_RS05395 (P3U34_05395) | - | 1058889..1059851 (+) | 963 | WP_065381331.1 | YqaJ viral recombinase family protein | - |
| P3U34_RS05400 (P3U34_05400) | - | 1059862..1060056 (+) | 195 | WP_065381330.1 | hypothetical protein | - |
| P3U34_RS05405 (P3U34_05405) | - | 1060058..1060870 (+) | 813 | WP_065381329.1 | recombinase RecT | - |
| P3U34_RS05410 (P3U34_05410) | - | 1060920..1061681 (+) | 762 | WP_323706568.1 | DnaD domain protein | - |
| P3U34_RS05415 (P3U34_05415) | - | 1061691..1062485 (+) | 795 | WP_323706569.1 | ATP-binding protein | - |
| P3U34_RS05420 (P3U34_05420) | - | 1062504..1062692 (+) | 189 | WP_065381326.1 | hypothetical protein | - |
| P3U34_RS05425 (P3U34_05425) | ssbA | 1062689..1063180 (+) | 492 | WP_323706570.1 | single-stranded DNA-binding protein | Machinery gene |
| P3U34_RS05430 (P3U34_05430) | - | 1063220..1063528 (+) | 309 | WP_323706571.1 | hypothetical protein | - |
| P3U34_RS05435 (P3U34_05435) | - | 1063521..1063817 (+) | 297 | WP_323706572.1 | hypothetical protein | - |
| P3U34_RS05440 (P3U34_05440) | - | 1063820..1064044 (+) | 225 | WP_323706573.1 | hypothetical protein | - |
| P3U34_RS05445 (P3U34_05445) | - | 1064069..1064773 (-) | 705 | WP_323706574.1 | CPBP family intramembrane glutamic endopeptidase | - |
| P3U34_RS05450 (P3U34_05450) | - | 1064882..1065172 (+) | 291 | WP_262674271.1 | hypothetical protein | - |
| P3U34_RS05455 (P3U34_05455) | - | 1065174..1065554 (+) | 381 | WP_323706575.1 | hypothetical protein | - |
| P3U34_RS05460 (P3U34_05460) | - | 1065557..1065796 (+) | 240 | WP_262674273.1 | hypothetical protein | - |
| P3U34_RS05465 (P3U34_05465) | - | 1065798..1066112 (+) | 315 | WP_323706576.1 | hypothetical protein | - |
| P3U34_RS05470 (P3U34_05470) | - | 1066320..1066655 (-) | 336 | WP_217843770.1 | hypothetical protein | - |
| P3U34_RS05475 (P3U34_05475) | - | 1066943..1067374 (+) | 432 | WP_323706577.1 | YopX family protein | - |
| P3U34_RS05480 (P3U34_05480) | - | 1067378..1067551 (+) | 174 | WP_262674276.1 | hypothetical protein | - |
| P3U34_RS05485 (P3U34_05485) | - | 1067552..1068004 (+) | 453 | WP_262674277.1 | class I SAM-dependent methyltransferase | - |
| P3U34_RS05490 (P3U34_05490) | - | 1068091..1068291 (+) | 201 | WP_084756727.1 | hypothetical protein | - |
| P3U34_RS05495 (P3U34_05495) | - | 1068593..1069090 (+) | 498 | WP_262674278.1 | Holliday junction resolvase RecU | - |
| P3U34_RS05500 (P3U34_05500) | - | 1069113..1069517 (+) | 405 | WP_262674279.1 | hypothetical protein | - |
| P3U34_RS05505 (P3U34_05505) | - | 1069766..1070536 (+) | 771 | WP_262674280.1 | hypothetical protein | - |
| P3U34_RS05510 (P3U34_05510) | - | 1070584..1070769 (+) | 186 | WP_262674281.1 | hypothetical protein | - |
| P3U34_RS05515 (P3U34_05515) | - | 1070900..1071391 (+) | 492 | WP_262674282.1 | helix-turn-helix domain-containing protein | - |
| P3U34_RS05520 (P3U34_05520) | terL | 1071384..1072787 (+) | 1404 | WP_410250465.1 | phage terminase large subunit | - |
| P3U34_RS05525 (P3U34_05525) | - | 1072799..1074415 (+) | 1617 | WP_323706579.1 | hypothetical protein | - |
| P3U34_RS05530 (P3U34_05530) | - | 1074424..1075473 (+) | 1050 | WP_323706580.1 | phage minor capsid protein | - |
| P3U34_RS05535 (P3U34_05535) | - | 1075479..1075730 (+) | 252 | WP_232179975.1 | hypothetical protein | - |
| P3U34_RS05540 (P3U34_05540) | - | 1075948..1076556 (+) | 609 | WP_323706581.1 | phage scaffolding protein | - |
| P3U34_RS05545 (P3U34_05545) | - | 1076560..1076931 (+) | 372 | WP_070373223.1 | hypothetical protein | - |
| P3U34_RS05550 (P3U34_05550) | - | 1076971..1077996 (+) | 1026 | WP_323706582.1 | major capsid protein | - |
| P3U34_RS05555 (P3U34_05555) | - | 1078076..1078429 (+) | 354 | WP_323706583.1 | hypothetical protein | - |
| P3U34_RS05560 (P3U34_05560) | - | 1078426..1078764 (+) | 339 | WP_323706584.1 | hypothetical protein | - |
| P3U34_RS05565 (P3U34_05565) | - | 1078831..1079250 (+) | 420 | WP_182683143.1 | HK97 gp10 family phage protein | - |
| P3U34_RS05570 (P3U34_05570) | - | 1079251..1079661 (+) | 411 | WP_070373228.1 | hypothetical protein | - |
| P3U34_RS05575 (P3U34_05575) | - | 1079699..1080307 (+) | 609 | WP_070373229.1 | hypothetical protein | - |
| P3U34_RS05580 (P3U34_05580) | - | 1080402..1080878 (+) | 477 | WP_323706585.1 | Ig domain-containing protein | - |
| P3U34_RS05585 (P3U34_05585) | - | 1080953..1081540 (+) | 588 | WP_084756744.1 | hypothetical protein | - |
| P3U34_RS05590 (P3U34_05590) | - | 1081630..1081878 (+) | 249 | WP_239371978.1 | hypothetical protein | - |
| P3U34_RS05595 (P3U34_05595) | - | 1081912..1086279 (+) | 4368 | WP_323706586.1 | tape measure protein | - |
| P3U34_RS05600 (P3U34_05600) | - | 1086280..1087122 (+) | 843 | WP_262674294.1 | phage tail family protein | - |
| P3U34_RS05605 (P3U34_05605) | - | 1087133..1088686 (+) | 1554 | WP_323706587.1 | prophage endopeptidase tail family protein | - |
| P3U34_RS05610 (P3U34_05610) | - | 1088679..1089197 (+) | 519 | WP_167811840.1 | hypothetical protein | - |
| P3U34_RS05615 (P3U34_05615) | - | 1089210..1090916 (+) | 1707 | WP_262674296.1 | phosphodiester glycosidase family protein | - |
| P3U34_RS05620 (P3U34_05620) | - | 1090931..1092586 (+) | 1656 | WP_323706589.1 | BppU family phage baseplate upper protein | - |
| P3U34_RS05625 (P3U34_05625) | - | 1092589..1093086 (+) | 498 | WP_262674298.1 | XkdX family protein | - |
| P3U34_RS05630 (P3U34_05630) | - | 1093155..1093607 (+) | 453 | WP_323706590.1 | phage holin family protein | - |
| P3U34_RS05635 (P3U34_05635) | - | 1093692..1094546 (+) | 855 | WP_262674300.1 | N-acetylmuramoyl-L-alanine amidase | - |
| P3U34_RS14220 | - | 1094803..1095189 (+) | 387 | Protein_1073 | CHAP domain-containing protein | - |
| P3U34_RS14225 | - | 1095172..1095504 (+) | 333 | WP_369089473.1 | SH3 domain-containing protein | - |
Sequence
Protein
Download Length: 163 a.a. Molecular weight: 18412.18 Da Isoelectric Point: 8.4257
>NTDB_id=802966 P3U34_RS05425 WP_323706570.1 1062689..1063180(+) (ssbA) [Mammaliicoccus sciuri strain Dog108]
MINSTTLVGRLTKDPELRTTPSGVEVGNFTLAVNRTFTNQNGEREADFINCIVFRKQAVNVNQYLSKGKLAGIVGRLQTR
SYENKEGQKVYVTEVVCDNVQFLEPKDSQNNSNSYQNGTNYQKGNNYSQNNQNVQKGQNKTKYDQQNNPFTNGSQLNDDD
LPF
MINSTTLVGRLTKDPELRTTPSGVEVGNFTLAVNRTFTNQNGEREADFINCIVFRKQAVNVNQYLSKGKLAGIVGRLQTR
SYENKEGQKVYVTEVVCDNVQFLEPKDSQNNSNSYQNGTNYQKGNNYSQNNQNVQKGQNKTKYDQQNNPFTNGSQLNDDD
LPF
Nucleotide
Download Length: 492 bp
>NTDB_id=802966 P3U34_RS05425 WP_323706570.1 1062689..1063180(+) (ssbA) [Mammaliicoccus sciuri strain Dog108]
ATGATCAATTCCACAACTCTTGTAGGACGTTTAACGAAAGACCCAGAACTCAGAACAACACCTAGTGGTGTAGAAGTAGG
TAATTTTACTTTGGCAGTCAATCGCACATTTACTAATCAAAACGGTGAACGTGAAGCTGACTTCATAAATTGCATTGTAT
TTAGAAAACAAGCAGTAAACGTCAATCAATATTTATCTAAAGGTAAGTTAGCTGGTATTGTTGGGCGACTTCAAACAAGA
AGTTATGAAAACAAAGAAGGACAAAAAGTATATGTTACTGAAGTTGTTTGCGACAATGTCCAATTTTTAGAGCCTAAAGA
TAGTCAAAACAACTCAAATTCGTATCAAAATGGAACGAATTATCAAAAAGGTAATAACTATAGCCAAAACAATCAAAATG
TCCAAAAAGGGCAAAATAAAACGAAATATGACCAACAGAATAATCCATTTACAAATGGTAGTCAATTAAATGATGATGAC
TTACCTTTTTAA
ATGATCAATTCCACAACTCTTGTAGGACGTTTAACGAAAGACCCAGAACTCAGAACAACACCTAGTGGTGTAGAAGTAGG
TAATTTTACTTTGGCAGTCAATCGCACATTTACTAATCAAAACGGTGAACGTGAAGCTGACTTCATAAATTGCATTGTAT
TTAGAAAACAAGCAGTAAACGTCAATCAATATTTATCTAAAGGTAAGTTAGCTGGTATTGTTGGGCGACTTCAAACAAGA
AGTTATGAAAACAAAGAAGGACAAAAAGTATATGTTACTGAAGTTGTTTGCGACAATGTCCAATTTTTAGAGCCTAAAGA
TAGTCAAAACAACTCAAATTCGTATCAAAATGGAACGAATTATCAAAAAGGTAATAACTATAGCCAAAACAATCAAAATG
TCCAAAAAGGGCAAAATAAAACGAAATATGACCAACAGAATAATCCATTTACAAATGGTAGTCAATTAAATGATGATGAC
TTACCTTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.07 |
100 |
0.571 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
48.824 |
100 |
0.509 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
54.867 |
69.325 |
0.38 |