Detailed information NTG0801915

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: P3U75_RS06945
• Genome accession: NZ_CP120028
• Coordinates: 1379677..1379994 (+)
• Length: 105 a.a.
• NCBI ID: WP_323707958.1
• Uniprot ID: -
• Organism: Mammaliicoccus sciuri strain Dog142
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1374677..1384994

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
P3U75_RS06905 (P3U75_06895)	-	1374822..1375013 (+)	192	WP_078099923.1	YqgQ family protein	-
P3U75_RS06910 (P3U75_06900)	-	1375010..1375981 (+)	972	WP_025904167.1	ROK family glucokinase	-
P3U75_RS06915 (P3U75_06905)	-	1375981..1376295 (+)	315	WP_058611614.1	MTH1187 family thiamine-binding protein	-
P3U75_RS06920 (P3U75_06910)	-	1376325..1376564 (-)	240	WP_016911885.1	DUF2759 domain-containing protein	-
P3U75_RS06925 (P3U75_06915)	-	1376662..1377294 (+)	633	WP_058611613.1	MBL fold metallo-hydrolase	-
P3U75_RS06930 (P3U75_06920)	-	1377328..1377576 (-)	249	WP_025904960.1	DUF2626 family protein	-
P3U75_RS06935 (P3U75_06925)	comGA	1377730..1378632 (+)	903	WP_058611612.1	competence type IV pilus ATPase ComGA	Machinery gene
P3U75_RS06940 (P3U75_06930)	comGB	1378622..1379662 (+)	1041	WP_077152202.1	competence type IV pilus assembly protein ComGB	-
P3U75_RS06945 (P3U75_06935)	comGC	1379677..1379994 (+)	318	WP_323707958.1	competence type IV pilus major pilin ComGC	Machinery gene
P3U75_RS06950 (P3U75_06940)	-	1380023..1380421 (+)	399	WP_049319406.1	hypothetical protein	-
P3U75_RS06955 (P3U75_06945)	comGE	1380405..1380686 (+)	282	WP_058611610.1	competence type IV pilus minor pilin ComGE	-
P3U75_RS06960 (P3U75_06950)	-	1380661..1381095 (+)	435	WP_049318781.1	competence type IV pilus minor pilin ComGF	-
P3U75_RS06965 (P3U75_06955)	-	1381330..1381818 (+)	489	WP_058611609.1	shikimate kinase	-
P3U75_RS06970 (P3U75_06960)	gcvT	1382011..1383099 (+)	1089	WP_058611608.1	glycine cleavage system aminomethyltransferase GcvT	-
P3U75_RS06975 (P3U75_06965)	gcvPA	1383111..1384454 (+)	1344	WP_058611607.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11633.73 Da
• Isoelectric Point: 9.1197

>NTDB_id=801915 P3U75_RS06945 WP_323707958.1 1379677..1379994(+) (comGC) [Mammaliicoccus sciuri strain Dog142]
MKRFKFLSKKEGFTLVEMLIVLLIISILLVIIIPNISKQSETVKSTGCQAQVKMVAGQVEAYTLKHDAKPNSINDLISDG
YINRKQLTCKSGETITLENGEVVAH

Nucleotide

• Length: 318 bp

>NTDB_id=801915 P3U75_RS06945 WP_323707958.1 1379677..1379994(+) (comGC) [Mammaliicoccus sciuri strain Dog142]
ATGAAAAGATTTAAATTTTTAAGTAAAAAAGAAGGGTTTACATTGGTTGAAATGTTAATTGTCCTTTTAATCATAAGTAT
ATTATTGGTGATCATCATACCAAACATCAGCAAGCAATCAGAGACGGTAAAAAGTACTGGATGCCAAGCACAAGTGAAAA
TGGTAGCTGGTCAAGTAGAAGCTTATACATTGAAACACGATGCTAAACCAAATTCTATAAATGATTTAATAAGTGATGGC
TATATTAACCGAAAGCAACTGACTTGTAAATCAGGAGAAACAATTACGCTAGAAAACGGTGAAGTTGTTGCACATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-32)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	65.686	97.143	0.638
comGC	Staphylococcus aureus N315	65.686	97.143	0.638
comGC	Bacillus subtilis subsp. subtilis str. 168	47.312	88.571	0.419
comYC	Streptococcus mutans UA140	47.126	82.857	0.39
comYC	Streptococcus mutans UA159	47.126	82.857	0.39
comYC	Streptococcus gordonii str. Challis substr. CH1	46.512	81.905	0.381
comGC/cglC	Streptococcus mitis NCTC 12261	46.988	79.048	0.371
comGC/cglC	Streptococcus mitis SK321	46.988	79.048	0.371
comYC	Streptococcus suis isolate S10	48.718	74.286	0.362