Detailed information NTG0796724

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: PYW36_RS05825
• Genome accession: NZ_CP118953
• Coordinates: 1188152..1188469 (+)
• Length: 105 a.a.
• NCBI ID: WP_037573894.1
• Uniprot ID: A0AAE5W8Q2
• Organism: Staphylococcus chromogenes strain DSM 20454
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1183152..1193469

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PYW36_RS05795	-	1183939..1184142 (+)	204	WP_037573910.1	YqgQ family protein	-
PYW36_RS05800	-	1184139..1185125 (+)	987	WP_037573907.1	ROK family glucokinase	-
PYW36_RS05805	-	1185126..1185437 (+)	312	WP_037573905.1	MTH1187 family thiamine-binding protein	-
PYW36_RS05810	-	1185451..1186074 (+)	624	WP_037573902.1	MBL fold metallo-hydrolase	-
PYW36_RS05815	comGA	1186127..1187101 (+)	975	WP_103158616.1	competence type IV pilus ATPase ComGA	Machinery gene
PYW36_RS05820	comGB	1187070..1188137 (+)	1068	WP_103158615.1	competence type IV pilus assembly protein ComGB	-
PYW36_RS05825	comGC	1188152..1188469 (+)	318	WP_037573894.1	competence type IV pilus major pilin ComGC	Machinery gene
PYW36_RS05830	comGD	1188459..1188890 (+)	432	WP_051604961.1	competence type IV pilus minor pilin ComGD	-
PYW36_RS05835	-	1188995..1189177 (+)	183	WP_133172104.1	hypothetical protein	-
PYW36_RS05840	-	1189194..1189568 (+)	375	WP_107374195.1	competence type IV pilus minor pilin ComGF	-
PYW36_RS05845	-	1189733..1190257 (+)	525	WP_103159095.1	shikimate kinase	-
PYW36_RS05850	gcvT	1190410..1191501 (+)	1092	WP_103159094.1	glycine cleavage system aminomethyltransferase GcvT	-
PYW36_RS05855	gcvPA	1191514..1192863 (+)	1350	WP_103159093.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11801.05 Da
• Isoelectric Point: 9.5646

>NTDB_id=796724 PYW36_RS05825 WP_037573894.1 1188152..1188469(+) (comGC) [Staphylococcus chromogenes strain DSM 20454]
MKLFKKLKENKGFTLIEMLLVLLIISVLLILIIPNIAKQSEHIQKTGCSAQLKLVESQIEAYTLKFNRKPSTIDELVQEG
YIKENQKSCKNGDTIILRGGEAVVS

Nucleotide

• Length: 318 bp

>NTDB_id=796724 PYW36_RS05825 WP_037573894.1 1188152..1188469(+) (comGC) [Staphylococcus chromogenes strain DSM 20454]
ATGAAATTATTTAAAAAGTTAAAAGAAAACAAGGGGTTTACGTTAATTGAAATGCTTTTAGTTTTGTTAATTATAAGTGT
ACTTTTAATACTAATTATTCCTAATATTGCTAAACAATCAGAACATATTCAAAAAACAGGTTGTTCAGCACAACTTAAAT
TAGTCGAAAGTCAAATTGAAGCATATACTTTGAAATTTAATCGAAAACCTTCAACAATCGACGAACTTGTTCAAGAAGGT
TATATCAAAGAAAATCAAAAATCATGCAAAAATGGAGACACCATCATATTACGTGGCGGAGAAGCCGTTGTTTCATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (10-32)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	66.99	98.095	0.657
comGC	Staphylococcus aureus MW2	66.99	98.095	0.657
comYC	Streptococcus gordonii str. Challis substr. CH1	50	81.905	0.41
comGC	Bacillus subtilis subsp. subtilis str. 168	44.681	89.524	0.4
comGC/cglC	Streptococcus pneumoniae R6	47.674	81.905	0.39
comGC/cglC	Streptococcus pneumoniae TIGR4	47.674	81.905	0.39
comGC/cglC	Streptococcus pneumoniae Rx1	47.674	81.905	0.39
comGC/cglC	Streptococcus pneumoniae D39	47.674	81.905	0.39
comGC/cglC	Streptococcus mitis SK321	49.383	77.143	0.381
comYC	Streptococcus mutans UA140	51.948	73.333	0.381
comYC	Streptococcus mutans UA159	51.948	73.333	0.381
comYC	Streptococcus suis isolate S10	51.316	72.381	0.371
comGC/cglC	Streptococcus mitis NCTC 12261	51.316	72.381	0.371