Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   Q7621_RS02355 Genome accession   NZ_CP131712
Coordinates   462330..462479 (+) Length   49 a.a.
NCBI ID   WP_001809846.1    Uniprot ID   Q00MV6
Organism   Streptococcus pneumoniae strain 2008C09-280     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context


Location: 457330..467479
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Q7621_RS02330 (Q7621_02335) comA/nlmT 458397..460073 (-) 1677 WP_196300924.1 peptide cleavage/export ABC transporter Regulator
  Q7621_RS02335 comA/nlmT 459967..460554 (-) 588 WP_000205166.1 cysteine peptidase family C39 domain-containing protein Regulator
  Q7621_RS02340 (Q7621_02340) blpI 460836..461033 (+) 198 WP_001093259.1 bacteriocin-like peptide BlpI -
  Q7621_RS02345 (Q7621_02345) blpJ 461500..461769 (+) 270 WP_001093248.1 bacteriocin-like peptide BlpJ -
  Q7621_RS02350 (Q7621_02350) blpK 461838..462086 (+) 249 WP_000379965.1 bacteriocin-like peptide BlpK -
  Q7621_RS02355 (Q7621_02355) cipB 462330..462479 (+) 150 WP_001809846.1 bacteriocin-like peptide BlpO Regulator
  Q7621_RS02360 (Q7621_02360) - 462583..462702 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  Q7621_RS02365 (Q7621_02365) - 463222..463541 (+) 320 Protein_464 immunity protein -
  Q7621_RS02370 (Q7621_02370) - 464170..464553 (+) 384 WP_000877381.1 hypothetical protein -
  Q7621_RS02375 (Q7621_02375) - 464605..465294 (+) 690 WP_000760532.1 CPBP family intramembrane glutamic endopeptidase -
  Q7621_RS02380 (Q7621_02380) blpZ 465336..465569 (+) 234 WP_000276498.1 immunity protein BlpZ -
  Q7621_RS02385 (Q7621_02385) - 465720..466331 (+) 612 WP_000394044.1 type II CAAX endopeptidase family protein -
  Q7621_RS02390 (Q7621_02390) - 466492..467286 (+) 795 WP_000363002.1 phosphotransferase family protein -

Sequence


Protein


Download         Length: 49 a.a.        Molecular weight: 5149.92 Da        Isoelectric Point: 4.0439

>NTDB_id=791620 Q7621_RS02355 WP_001809846.1 462330..462479(+) (cipB) [Streptococcus pneumoniae strain 2008C09-280]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=791620 Q7621_RS02355 WP_001809846.1 462330..462479(+) (cipB) [Streptococcus pneumoniae strain 2008C09-280]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q00MV6

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

53.061

100

0.531