Detailed information
Overview
| Name | cipB | Type | Regulator |
| Locus tag | Q7621_RS02355 | Genome accession | NZ_CP131712 |
| Coordinates | 462330..462479 (+) | Length | 49 a.a. |
| NCBI ID | WP_001809846.1 | Uniprot ID | Q00MV6 |
| Organism | Streptococcus pneumoniae strain 2008C09-280 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 457330..467479
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| Q7621_RS02330 (Q7621_02335) | comA/nlmT | 458397..460073 (-) | 1677 | WP_196300924.1 | peptide cleavage/export ABC transporter | Regulator |
| Q7621_RS02335 | comA/nlmT | 459967..460554 (-) | 588 | WP_000205166.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| Q7621_RS02340 (Q7621_02340) | blpI | 460836..461033 (+) | 198 | WP_001093259.1 | bacteriocin-like peptide BlpI | - |
| Q7621_RS02345 (Q7621_02345) | blpJ | 461500..461769 (+) | 270 | WP_001093248.1 | bacteriocin-like peptide BlpJ | - |
| Q7621_RS02350 (Q7621_02350) | blpK | 461838..462086 (+) | 249 | WP_000379965.1 | bacteriocin-like peptide BlpK | - |
| Q7621_RS02355 (Q7621_02355) | cipB | 462330..462479 (+) | 150 | WP_001809846.1 | bacteriocin-like peptide BlpO | Regulator |
| Q7621_RS02360 (Q7621_02360) | - | 462583..462702 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| Q7621_RS02365 (Q7621_02365) | - | 463222..463541 (+) | 320 | Protein_464 | immunity protein | - |
| Q7621_RS02370 (Q7621_02370) | - | 464170..464553 (+) | 384 | WP_000877381.1 | hypothetical protein | - |
| Q7621_RS02375 (Q7621_02375) | - | 464605..465294 (+) | 690 | WP_000760532.1 | CPBP family intramembrane glutamic endopeptidase | - |
| Q7621_RS02380 (Q7621_02380) | blpZ | 465336..465569 (+) | 234 | WP_000276498.1 | immunity protein BlpZ | - |
| Q7621_RS02385 (Q7621_02385) | - | 465720..466331 (+) | 612 | WP_000394044.1 | type II CAAX endopeptidase family protein | - |
| Q7621_RS02390 (Q7621_02390) | - | 466492..467286 (+) | 795 | WP_000363002.1 | phosphotransferase family protein | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5149.92 Da Isoelectric Point: 4.0439
>NTDB_id=791620 Q7621_RS02355 WP_001809846.1 462330..462479(+) (cipB) [Streptococcus pneumoniae strain 2008C09-280]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=791620 Q7621_RS02355 WP_001809846.1 462330..462479(+) (cipB) [Streptococcus pneumoniae strain 2008C09-280]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
53.061 |
100 |
0.531 |