Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   LDM85_RS06920 Genome accession   NZ_AP024963
Coordinates   1430815..1430940 (-) Length   41 a.a.
NCBI ID   WP_000688336.1    Uniprot ID   -
Organism   Helicobacter pylori strain #5     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1425815..1435940
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LDM85_RS06900 (OHP005_13880) - 1426509..1427920 (-) 1412 Protein_1354 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  LDM85_RS06905 (OHP005_13890) comB10 1427990..1429126 (-) 1137 WP_001045730.1 DNA type IV secretion system protein ComB10 Machinery gene
  LDM85_RS06910 (OHP005_13900) comB9 1429119..1430081 (-) 963 WP_001870928.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  LDM85_RS06915 (OHP005_13910) comB8 1430081..1430818 (-) 738 WP_000660542.1 virB8 family protein Machinery gene
  LDM85_RS06920 comB7 1430815..1430940 (-) 126 WP_000688336.1 hypothetical protein Machinery gene
  LDM85_RS06925 (OHP005_13920) comB6 1430956..1432011 (-) 1056 WP_223887936.1 P-type conjugative transfer protein TrbL Machinery gene
  LDM85_RS06930 (OHP005_13930) - 1432019..1433014 (-) 996 WP_223887937.1 PDZ domain-containing protein -
  LDM85_RS06935 (OHP005_13940) - 1433014..1433307 (-) 294 WP_000347923.1 YbaB/EbfC family nucleoid-associated protein -
  LDM85_RS06940 (OHP005_13950) panD 1433318..1433668 (-) 351 WP_073470207.1 aspartate 1-decarboxylase -
  LDM85_RS06945 (OHP005_13960) - 1433658..1435880 (-) 2223 WP_223887470.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4770.81 Da        Isoelectric Point: 9.3013

>NTDB_id=76193 LDM85_RS06920 WP_000688336.1 1430815..1430940(-) (comB7) [Helicobacter pylori strain #5]
MKIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=76193 LDM85_RS06920 WP_000688336.1 1430815..1430940(-) (comB7) [Helicobacter pylori strain #5]
ATGAAAATTTTTTTTGTTATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

85.366

100

0.854


Multiple sequence alignment