Detailed information
Bioinformatically predicted
Overview
| Name | pilE | Type | Machinery gene |
| Locus tag | OD459_RS27450 | Genome accession | NZ_CP107027 |
| Coordinates | 3249657..3249764 (+) | Length | 35 a.a. |
| NCBI ID | WP_412059427.1 | Uniprot ID | - |
| Organism | Cytobacillus firmus strain M7 | ||
| Function | assembly of type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 3249657..3263407 | 3249657..3249764 | within | 0 |
Gene organization within MGE regions
Location: 3249657..3263407
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OD459_RS27450 | pilE | 3249657..3249764 (+) | 108 | WP_412059427.1 | prepilin-type N-terminal cleavage/methylation domain-containing protein | Machinery gene |
| OD459_RS16645 (OD459_16645) | - | 3250338..3250973 (+) | 636 | WP_263599306.1 | sugar transferase | - |
| OD459_RS16650 (OD459_16650) | - | 3250970..3251821 (+) | 852 | WP_263599307.1 | NAD-dependent epimerase/dehydratase family protein | - |
| OD459_RS16655 (OD459_16655) | - | 3251823..3252929 (+) | 1107 | WP_263599308.1 | glycosyltransferase family 4 protein | - |
| OD459_RS16660 (OD459_16660) | - | 3252922..3253482 (+) | 561 | WP_263599309.1 | acyltransferase | - |
| OD459_RS16665 (OD459_16665) | - | 3253504..3254664 (+) | 1161 | WP_263599310.1 | glycosyltransferase | - |
| OD459_RS16670 (OD459_16670) | - | 3254671..3254860 (+) | 190 | Protein_3217 | polysaccharide biosynthesis protein | - |
| OD459_RS16675 (OD459_16675) | - | 3255245..3256309 (+) | 1065 | WP_263599311.1 | EpsG family protein | - |
| OD459_RS16680 (OD459_16680) | - | 3256316..3257527 (+) | 1212 | WP_263599312.1 | glycosyltransferase family 4 protein | - |
| OD459_RS16685 (OD459_16685) | - | 3257612..3258748 (+) | 1137 | WP_263599313.1 | glycosyltransferase | - |
| OD459_RS16690 (OD459_16690) | - | 3258750..3260096 (+) | 1347 | WP_263599314.1 | hypothetical protein | - |
| OD459_RS16695 (OD459_16695) | - | 3260113..3261150 (+) | 1038 | WP_263599315.1 | nucleoside-diphosphate sugar epimerase/dehydratase | - |
| OD459_RS16700 (OD459_16700) | - | 3261167..3262276 (+) | 1110 | WP_263599316.1 | capsular polysaccharide biosynthesis protein CapF | - |
| OD459_RS16705 (OD459_16705) | wecB | 3262280..3263407 (+) | 1128 | WP_263599317.1 | non-hydrolyzing UDP-N-acetylglucosamine 2-epimerase | - |
Sequence
Protein
Download Length: 35 a.a. Molecular weight: 3762.56 Da Isoelectric Point: 4.1051
>NTDB_id=737475 OD459_RS27450 WP_412059427.1 3249657..3249764(+) (pilE) [Cytobacillus firmus strain M7]
MEINKDKGFTLIEVIMVIAIVGIIAGISLPSVVYD
MEINKDKGFTLIEVIMVIAIVGIIAGISLPSVVYD
Nucleotide
Download Length: 108 bp
>NTDB_id=737475 OD459_RS27450 WP_412059427.1 3249657..3249764(+) (pilE) [Cytobacillus firmus strain M7]
ATGGAGATAAATAAAGATAAAGGATTTACTTTGATAGAAGTAATAATGGTTATCGCTATTGTTGGAATAATTGCAGGAAT
TTCTTTGCCTTCTGTAGTGTATGATTGA
ATGGAGATAAATAAAGATAAAGGATTTACTTTGATAGAAGTAATAATGGTTATCGCTATTGTTGGAATAATTGCAGGAAT
TTCTTTGCCTTCTGTAGTGTATGATTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.