Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   P8R49_RS16305 Genome accession   NZ_CP121266
Coordinates   3032137..3032277 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain 107105     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3027137..3037277
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P8R49_RS16280 (P8R49_16280) yuxO 3027414..3027794 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  P8R49_RS16285 (P8R49_16285) comA 3027813..3028457 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  P8R49_RS16290 (P8R49_16290) comP 3028538..3030850 (-) 2313 WP_014480703.1 sensor histidine kinase Regulator
  P8R49_RS16295 (P8R49_16295) comX 3030866..3031087 (-) 222 WP_014480704.1 competence pheromone ComX -
  P8R49_RS16300 (P8R49_16300) comQ 3031089..3031952 (-) 864 WP_014480705.1 polyprenyl synthetase family protein Regulator
  P8R49_RS16305 (P8R49_16305) degQ 3032137..3032277 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  P8R49_RS16310 (P8R49_16310) - 3032499..3032624 (+) 126 WP_003228793.1 hypothetical protein -
  P8R49_RS16315 (P8R49_16315) - 3032738..3033106 (+) 369 WP_014477834.1 hypothetical protein -
  P8R49_RS16320 (P8R49_16320) pdeH 3033082..3034311 (-) 1230 WP_014480707.1 cyclic di-GMP phosphodiesterase -
  P8R49_RS16325 (P8R49_16325) pncB 3034447..3035919 (-) 1473 WP_014480708.1 nicotinate phosphoribosyltransferase -
  P8R49_RS16330 (P8R49_16330) pncA 3035935..3036486 (-) 552 WP_014480709.1 isochorismatase family cysteine hydrolase -
  P8R49_RS16335 (P8R49_16335) yueI 3036583..3036981 (-) 399 WP_014480710.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=736782 P8R49_RS16305 WP_003220708.1 3032137..3032277(-) (degQ) [Bacillus subtilis strain 107105]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=736782 P8R49_RS16305 WP_003220708.1 3032137..3032277(-) (degQ) [Bacillus subtilis strain 107105]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1