Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | PYH73_RS07685 | Genome accession | NZ_CP118808 |
| Coordinates | 1581351..1581662 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | A0A0H2XGS7 |
| Organism | Staphylococcus aureus strain 7063 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1576351..1586662
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYH73_RS07650 (PYH73_07650) | gcvPA | 1576853..1578199 (-) | 1347 | WP_000019687.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| PYH73_RS07655 (PYH73_07655) | gcvT | 1578219..1579310 (-) | 1092 | WP_000093345.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| PYH73_RS07660 (PYH73_07660) | - | 1579469..1579993 (-) | 525 | WP_001015121.1 | shikimate kinase | - |
| PYH73_RS07665 (PYH73_07665) | - | 1579983..1580129 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| PYH73_RS07670 (PYH73_07670) | comGF | 1580226..1580723 (-) | 498 | WP_029694050.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| PYH73_RS07675 (PYH73_07675) | comGE | 1580641..1580940 (-) | 300 | WP_000844410.1 | hypothetical protein | Machinery gene |
| PYH73_RS07680 (PYH73_07680) | comGD | 1580927..1581373 (-) | 447 | WP_001788899.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| PYH73_RS07685 (PYH73_07685) | comGC | 1581351..1581662 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| PYH73_RS07690 (PYH73_07690) | comGB | 1581676..1582746 (-) | 1071 | WP_000776422.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| PYH73_RS07695 (PYH73_07695) | comGA | 1582718..1583692 (-) | 975 | WP_000697219.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| PYH73_RS07700 (PYH73_07700) | - | 1583744..1584367 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| PYH73_RS07705 (PYH73_07705) | - | 1584364..1584693 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| PYH73_RS07710 (PYH73_07710) | - | 1584693..1585679 (-) | 987 | WP_000161315.1 | ROK family glucokinase | - |
| PYH73_RS07715 (PYH73_07715) | - | 1585676..1585879 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=723653 PYH73_RS07685 WP_000472256.1 1581351..1581662(-) (comGC) [Staphylococcus aureus strain 7063]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=723653 PYH73_RS07685 WP_000472256.1 1581351..1581662(-) (comGC) [Staphylococcus aureus strain 7063]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comGC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comGC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |