Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | NW941_RS05340 | Genome accession | NZ_CP102963 |
| Coordinates | 1112632..1113102 (+) | Length | 156 a.a. |
| NCBI ID | WP_258411292.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain 40-B-50 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1087773..1142697 | 1112632..1113102 | within | 0 |
Gene organization within MGE regions
Location: 1087773..1142697
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW941_RS05170 (NW941_05190) | scb | 1087773..1088123 (+) | 351 | WP_000669537.1 | complement inhibitor SCIN-B | - |
| NW941_RS05175 (NW941_05200) | - | 1088832..1089017 (-) | 186 | WP_001032818.1 | hypothetical protein | - |
| NW941_RS05180 (NW941_05205) | - | 1089639..1089872 (-) | 234 | WP_000231632.1 | hypothetical protein | - |
| NW941_RS05185 (NW941_05210) | hyl | 1090349..1091308 (-) | 960 | WP_000857485.1 | alpha-hemolysin | - |
| NW941_RS05190 (NW941_05215) | - | 1091981..1092127 (+) | 147 | WP_258410566.1 | hypothetical protein | - |
| NW941_RS05195 (NW941_05220) | - | 1092084..1092308 (+) | 225 | WP_258410567.1 | hypothetical protein | - |
| NW941_RS05200 (NW941_05225) | - | 1092753..1093469 (-) | 717 | WP_258411076.1 | superantigen-like protein SSL12 | - |
| NW941_RS05205 (NW941_05230) | - | 1093577..1094302 (-) | 726 | WP_001063559.1 | superantigen-like protein SSL13 | - |
| NW941_RS05210 (NW941_05235) | - | 1094397..1095122 (-) | 726 | WP_000739541.1 | superantigen-like protein SSL14 | - |
| NW941_RS05215 (NW941_05240) | argF | 1095560..1096561 (+) | 1002 | WP_000793607.1 | ornithine carbamoyltransferase | - |
| NW941_RS05220 (NW941_05245) | arcC | 1096584..1097516 (+) | 933 | WP_258411077.1 | carbamate kinase | - |
| NW941_RS05225 (NW941_05250) | - | 1097688..1099244 (+) | 1557 | WP_000432069.1 | YfcC family protein | - |
| NW941_RS05230 (NW941_05255) | - | 1099551..1099778 (+) | 228 | WP_000149423.1 | hypothetical protein | - |
| NW941_RS05235 (NW941_05260) | - | 1100083..1101030 (-) | 948 | WP_001239286.1 | TDT family transporter | - |
| NW941_RS05240 (NW941_05265) | - | 1101279..1101467 (+) | 189 | WP_001245802.1 | hypothetical protein | - |
| NW941_RS05245 (NW941_05270) | - | 1102015..1103046 (-) | 1032 | WP_258412913.1 | site-specific integrase | - |
| NW941_RS05250 (NW941_05275) | - | 1103153..1103497 (-) | 345 | WP_258412914.1 | DUF3969 family protein | - |
| NW941_RS05255 (NW941_05280) | - | 1103497..1103979 (-) | 483 | WP_258412915.1 | hypothetical protein | - |
| NW941_RS05260 (NW941_05285) | - | 1104148..1104762 (-) | 615 | WP_258415209.1 | hypothetical protein | - |
| NW941_RS05265 (NW941_05290) | - | 1104787..1105248 (-) | 462 | WP_258412917.1 | toxin | - |
| NW941_RS05270 (NW941_05295) | - | 1105261..1105593 (-) | 333 | WP_258412918.1 | helix-turn-helix transcriptional regulator | - |
| NW941_RS05275 (NW941_05300) | - | 1105757..1105966 (+) | 210 | WP_196429541.1 | helix-turn-helix transcriptional regulator | - |
| NW941_RS05280 (NW941_05305) | - | 1106040..1106357 (+) | 318 | WP_196429542.1 | hypothetical protein | - |
| NW941_RS05285 (NW941_05310) | - | 1106400..1106633 (+) | 234 | WP_258411822.1 | DUF2829 domain-containing protein | - |
| NW941_RS05290 (NW941_05315) | - | 1106614..1106979 (-) | 366 | WP_258412919.1 | hypothetical protein | - |
| NW941_RS05295 (NW941_05320) | - | 1107034..1107717 (+) | 684 | WP_258412920.1 | BRO family protein | - |
| NW941_RS05300 (NW941_05325) | - | 1107733..1107948 (+) | 216 | WP_258412921.1 | DUF771 domain-containing protein | - |
| NW941_RS05305 (NW941_05330) | - | 1107963..1108124 (+) | 162 | WP_209025520.1 | DUF1270 family protein | - |
| NW941_RS05310 (NW941_05335) | - | 1108219..1108521 (+) | 303 | WP_258411295.1 | DUF2482 family protein | - |
| NW941_RS05315 (NW941_05340) | - | 1108526..1108786 (+) | 261 | WP_113555199.1 | DUF1108 family protein | - |
| NW941_RS05320 (NW941_05345) | - | 1108795..1109058 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| NW941_RS05325 (NW941_05350) | - | 1109067..1111011 (+) | 1945 | Protein_1039 | AAA family ATPase | - |
| NW941_RS05330 (NW941_05355) | - | 1111013..1111933 (+) | 921 | WP_258415210.1 | recombinase RecT | - |
| NW941_RS05335 (NW941_05360) | - | 1112014..1112631 (+) | 618 | WP_258415235.1 | MBL fold metallo-hydrolase | - |
| NW941_RS05340 (NW941_05365) | ssbA | 1112632..1113102 (+) | 471 | WP_258411292.1 | single-stranded DNA-binding protein | Machinery gene |
| NW941_RS05345 (NW941_05370) | - | 1113132..1114016 (+) | 885 | WP_258411291.1 | DnaD domain protein | - |
| NW941_RS05350 (NW941_05375) | - | 1114023..1114241 (+) | 219 | WP_000338527.1 | hypothetical protein | - |
| NW941_RS05355 (NW941_05380) | - | 1114250..1114654 (+) | 405 | WP_258411290.1 | RusA family crossover junction endodeoxyribonuclease | - |
| NW941_RS05360 (NW941_05385) | - | 1114667..1115035 (+) | 369 | WP_258411289.1 | SA1788 family PVL leukocidin-associated protein | - |
| NW941_RS05365 (NW941_05390) | - | 1115039..1115281 (+) | 243 | WP_258411288.1 | phi PVL orf 51-like protein | - |
| NW941_RS05370 (NW941_05395) | - | 1115296..1115703 (+) | 408 | WP_070005477.1 | hypothetical protein | - |
| NW941_RS05375 (NW941_05400) | - | 1115700..1115894 (+) | 195 | WP_258412215.1 | hypothetical protein | - |
| NW941_RS05380 (NW941_05405) | - | 1115891..1116328 (+) | 438 | WP_258415211.1 | YopX family protein | - |
| NW941_RS05385 (NW941_05410) | - | 1116325..1116819 (+) | 495 | WP_258412213.1 | class I SAM-dependent methyltransferase | - |
| NW941_RS05390 (NW941_05415) | - | 1116792..1117301 (+) | 510 | WP_258412212.1 | hypothetical protein | - |
| NW941_RS05395 (NW941_05420) | - | 1117298..1117708 (+) | 411 | WP_153100471.1 | acetyltransferase | - |
| NW941_RS05400 (NW941_05425) | - | 1117701..1117955 (+) | 255 | WP_017804684.1 | DUF1024 family protein | - |
| NW941_RS05405 (NW941_05430) | - | 1117942..1118112 (+) | 171 | WP_258415212.1 | hypothetical protein | - |
| NW941_RS05410 (NW941_05435) | - | 1118105..1118635 (+) | 531 | WP_070005483.1 | dUTP pyrophosphatase | - |
| NW941_RS05415 (NW941_05440) | - | 1118672..1118932 (+) | 261 | WP_258415213.1 | hypothetical protein | - |
| NW941_RS05420 (NW941_05445) | - | 1119077..1119283 (+) | 207 | WP_258410180.1 | DUF1381 domain-containing protein | - |
| NW941_RS05425 (NW941_05450) | - | 1119280..1119480 (+) | 201 | WP_258410179.1 | hypothetical protein | - |
| NW941_RS05430 (NW941_05455) | - | 1119473..1119622 (+) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| NW941_RS05435 (NW941_05460) | - | 1119622..1119816 (+) | 195 | WP_258412527.1 | DUF1514 family protein | - |
| NW941_RS05440 (NW941_05465) | - | 1119844..1120260 (+) | 417 | WP_000590126.1 | hypothetical protein | - |
| NW941_RS05445 (NW941_05470) | - | 1120492..1120791 (+) | 300 | WP_000988332.1 | HNH endonuclease | - |
| NW941_RS05450 (NW941_05475) | - | 1120921..1121265 (+) | 345 | WP_258412937.1 | hypothetical protein | - |
| NW941_RS05455 (NW941_05480) | - | 1121262..1122923 (+) | 1662 | WP_258412938.1 | terminase large subunit | - |
| NW941_RS05460 (NW941_05485) | - | 1122938..1124086 (+) | 1149 | WP_258412939.1 | phage portal protein | - |
| NW941_RS05465 (NW941_05490) | - | 1124083..1124805 (+) | 723 | WP_258412940.1 | head maturation protease, ClpP-related | - |
| NW941_RS05470 (NW941_05495) | - | 1124829..1125968 (+) | 1140 | WP_258415214.1 | phage major capsid protein | - |
| NW941_RS05475 (NW941_05500) | - | 1125987..1126265 (+) | 279 | WP_000005716.1 | hypothetical protein | - |
| NW941_RS05480 (NW941_05505) | - | 1126274..1126555 (+) | 282 | WP_258411279.1 | phage head-tail adapter protein | - |
| NW941_RS05485 (NW941_05510) | - | 1126539..1126901 (+) | 363 | WP_031872356.1 | head-tail adaptor protein | - |
| NW941_RS05490 (NW941_05515) | - | 1126898..1127302 (+) | 405 | WP_070004532.1 | HK97 gp10 family phage protein | - |
| NW941_RS05495 (NW941_05520) | - | 1127299..1127703 (+) | 405 | WP_000565500.1 | hypothetical protein | - |
| NW941_RS05500 (NW941_05525) | - | 1127707..1128351 (+) | 645 | WP_258413102.1 | major tail protein | - |
| NW941_RS05505 (NW941_05530) | - | 1128378..1128617 (+) | 240 | WP_094969769.1 | Ig-like domain-containing protein | - |
| NW941_RS05510 (NW941_05535) | - | 1128667..1129017 (+) | 351 | WP_031906184.1 | hypothetical protein | - |
| NW941_RS05515 (NW941_05540) | - | 1129071..1129205 (+) | 135 | WP_258413364.1 | hypothetical protein | - |
| NW941_RS05520 (NW941_05545) | - | 1129262..1133788 (+) | 4527 | WP_258415215.1 | phage tail tape measure protein | - |
| NW941_RS05525 (NW941_05550) | - | 1133788..1135272 (+) | 1485 | WP_258412946.1 | phage tail family protein | - |
| NW941_RS05530 (NW941_05555) | - | 1135288..1139895 (+) | 4608 | WP_258415216.1 | phage tail spike protein | - |
| NW941_RS05535 (NW941_05560) | - | 1139888..1140040 (+) | 153 | WP_196429569.1 | hypothetical protein | - |
| NW941_RS05540 (NW941_05565) | - | 1140086..1140373 (+) | 288 | WP_031763773.1 | hypothetical protein | - |
| NW941_RS05545 (NW941_05570) | - | 1140429..1140803 (+) | 375 | WP_000340977.1 | hypothetical protein | - |
| NW941_RS05550 (NW941_05575) | - | 1140930..1141232 (+) | 303 | WP_031872328.1 | phage holin | - |
| NW941_RS05555 (NW941_05580) | - | 1141243..1142697 (+) | 1455 | WP_258412949.1 | N-acetylmuramoyl-L-alanine amidase | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17653.53 Da Isoelectric Point: 5.9191
>NTDB_id=720657 NW941_RS05340 WP_258411292.1 1112632..1113102(+) (ssbA) [Staphylococcus aureus strain 40-B-50]
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNTNDSQQDLYQHQAQQTRGQSQYPYNKPVKDNPFANANGPIEIDDNDLPF
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNTNDSQQDLYQHQAQQTRGQSQYPYNKPVKDNPFANANGPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=720657 NW941_RS05340 WP_258411292.1 1112632..1113102(+) (ssbA) [Staphylococcus aureus strain 40-B-50]
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACGAATGCACAAGGCGAGCGCGAGGCAGATTTTATTAATGTCATTGTAT
TTAAAAAACAAGCAGAGAATGTAAATAAATACCTATCTAAAGGATCATTGGCGGGCGTAGATGGCAGATTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAGGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CACAAATGACTCCCAACAAGATTTATACCAACATCAAGCGCAACAAACACGTGGGCAATCTCAATATCCATATAACAAAC
CAGTAAAAGATAATCCGTTCGCAAATGCGAATGGTCCGATTGAAATAGATGACAATGATTTACCGTTCTAA
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACGAATGCACAAGGCGAGCGCGAGGCAGATTTTATTAATGTCATTGTAT
TTAAAAAACAAGCAGAGAATGTAAATAAATACCTATCTAAAGGATCATTGGCGGGCGTAGATGGCAGATTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAGGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CACAAATGACTCCCAACAAGATTTATACCAACATCAAGCGCAACAAACACGTGGGCAATCTCAATATCCATATAACAAAC
CAGTAAAAGATAATCCGTTCGCAAATGCGAATGGTCCGATTGAAATAGATGACAATGATTTACCGTTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
52.353 |
100 |
0.571 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Vibrio cholerae strain A1552 |
32.065 |
100 |
0.378 |