Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | NF392_RS08920 | Genome accession | NZ_CP102089 |
| Coordinates | 1874718..1875131 (-) | Length | 137 a.a. |
| NCBI ID | WP_049399325.1 | Uniprot ID | - |
| Organism | Staphylococcus capitis subsp. capitis strain H17 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1837968..1883667 | 1874718..1875131 | within | 0 |
Gene organization within MGE regions
Location: 1837968..1883667
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NF392_RS08650 | - | 1837968..1838165 (-) | 198 | WP_023350503.1 | hypothetical protein | - |
| NF392_RS08655 | - | 1839115..1839300 (-) | 186 | WP_023350504.1 | hypothetical protein | - |
| NF392_RS08660 | - | 1839302..1839412 (-) | 111 | WP_049307399.1 | hypothetical protein | - |
| NF392_RS08665 | - | 1839483..1839634 (-) | 152 | Protein_1675 | hypothetical protein | - |
| NF392_RS08670 | - | 1839781..1841244 (-) | 1464 | WP_023350505.1 | SH3 domain-containing protein | - |
| NF392_RS08675 | - | 1841219..1841629 (-) | 411 | WP_023350506.1 | phage holin | - |
| NF392_RS08680 | - | 1841674..1842207 (-) | 534 | WP_023350507.1 | hypothetical protein | - |
| NF392_RS08685 | - | 1842207..1842722 (-) | 516 | WP_023350508.1 | hypothetical protein | - |
| NF392_RS08690 | - | 1842764..1842910 (-) | 147 | WP_023350509.1 | XkdX family protein | - |
| NF392_RS08695 | - | 1842903..1843247 (-) | 345 | WP_023350510.1 | hypothetical protein | - |
| NF392_RS08700 | - | 1843259..1844917 (-) | 1659 | WP_023350511.1 | BppU family phage baseplate upper protein | - |
| NF392_RS08705 | - | 1844970..1846172 (-) | 1203 | WP_080978319.1 | N-acetylglucosaminidase | - |
| NF392_RS08710 | - | 1846764..1847096 (-) | 333 | WP_080668898.1 | CHAP domain-containing protein | - |
| NF392_RS08715 | - | 1847372..1847503 (-) | 132 | WP_023350514.1 | hypothetical protein | - |
| NF392_RS08720 | - | 1847557..1847955 (-) | 399 | WP_037560594.1 | hypothetical protein | - |
| NF392_RS08725 | - | 1847936..1848358 (-) | 423 | WP_260832735.1 | hypothetical protein | - |
| NF392_RS08730 | - | 1848372..1849559 (-) | 1188 | WP_023350517.1 | BppU family phage baseplate upper protein | - |
| NF392_RS08735 | - | 1849572..1851446 (-) | 1875 | WP_124778642.1 | M14 family metallopeptidase | - |
| NF392_RS08740 | - | 1851449..1852909 (-) | 1461 | WP_023350519.1 | DUF7643 domain-containing protein | - |
| NF392_RS08745 | - | 1852921..1853877 (-) | 957 | WP_023350520.1 | phage tail domain-containing protein | - |
| NF392_RS08750 | - | 1853889..1857818 (-) | 3930 | WP_049399432.1 | tail protein | - |
| NF392_RS08755 | - | 1857833..1858177 (-) | 345 | WP_023350522.1 | hypothetical protein | - |
| NF392_RS08760 | - | 1858219..1858578 (-) | 360 | WP_023350523.1 | tail assembly chaperone | - |
| NF392_RS08765 | - | 1858641..1859195 (-) | 555 | WP_002436441.1 | phage major tail protein, TP901-1 family | - |
| NF392_RS08770 | - | 1859242..1859631 (-) | 390 | WP_023350524.1 | hypothetical protein | - |
| NF392_RS08775 | - | 1859925..1860611 (-) | 687 | WP_023350525.1 | hypothetical protein | - |
| NF392_RS08780 | - | 1860735..1860983 (-) | 249 | Protein_1698 | hypothetical protein | - |
| NF392_RS08785 | - | 1860983..1861285 (-) | 303 | WP_023350527.1 | hypothetical protein | - |
| NF392_RS08790 | - | 1861282..1861611 (-) | 330 | WP_002436519.1 | phage head-tail connector protein | - |
| NF392_RS08795 | - | 1861613..1861882 (-) | 270 | WP_023350528.1 | hypothetical protein | - |
| NF392_RS08800 | - | 1861905..1862819 (-) | 915 | WP_260832742.1 | phage major capsid protein | - |
| NF392_RS08805 | - | 1862836..1863450 (-) | 615 | WP_023350530.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| NF392_RS08810 | - | 1863703..1863846 (-) | 144 | WP_002436512.1 | hypothetical protein | - |
| NF392_RS08815 | - | 1863839..1864384 (-) | 546 | WP_023350531.1 | hypothetical protein | - |
| NF392_RS08820 | - | 1864404..1865354 (-) | 951 | WP_049399435.1 | minor capsid protein | - |
| NF392_RS08825 | - | 1865361..1866857 (-) | 1497 | WP_023350534.1 | phage portal protein | - |
| NF392_RS08830 | - | 1866871..1868163 (-) | 1293 | WP_023350535.1 | PBSX family phage terminase large subunit | - |
| NF392_RS08835 | - | 1868156..1868497 (-) | 342 | WP_049307394.1 | phBC6A51 family helix-turn-helix protein | - |
| NF392_RS08840 | - | 1868775..1869191 (-) | 417 | WP_002436508.1 | hypothetical protein | - |
| NF392_RS08845 | rinB | 1869262..1869432 (-) | 171 | WP_002469957.1 | transcriptional activator RinB | - |
| NF392_RS08850 | - | 1869438..1869578 (-) | 141 | WP_002475527.1 | DUF1381 domain-containing protein | - |
| NF392_RS08855 | - | 1869580..1869756 (-) | 177 | WP_023350538.1 | hypothetical protein | - |
| NF392_RS08860 | dut | 1869793..1870218 (-) | 426 | WP_049388193.1 | dUTP diphosphatase | - |
| NF392_RS08865 | - | 1870220..1870417 (-) | 198 | WP_023350541.1 | hypothetical protein | - |
| NF392_RS08870 | - | 1870401..1870955 (-) | 555 | WP_023350542.1 | nucleoside 2-deoxyribosyltransferase | - |
| NF392_RS08875 | - | 1870958..1871155 (-) | 198 | WP_023350543.1 | hypothetical protein | - |
| NF392_RS08880 | - | 1871156..1871503 (-) | 348 | WP_023350544.1 | SA1788 family PVL leukocidin-associated protein | - |
| NF392_RS08885 | - | 1871504..1871695 (-) | 192 | WP_023350545.1 | hypothetical protein | - |
| NF392_RS08890 | - | 1871685..1872095 (-) | 411 | WP_023350546.1 | DUF1064 domain-containing protein | - |
| NF392_RS08895 | - | 1872104..1872349 (-) | 246 | WP_002469995.1 | DUF3269 family protein | - |
| NF392_RS08900 | - | 1872352..1872507 (-) | 156 | WP_002469952.1 | hypothetical protein | - |
| NF392_RS08905 | - | 1872501..1873271 (-) | 771 | WP_002470008.1 | ATP-binding protein | - |
| NF392_RS08910 | - | 1873282..1874037 (-) | 756 | WP_037560596.1 | conserved phage C-terminal domain-containing protein | - |
| NF392_RS08915 | - | 1874024..1874704 (-) | 681 | WP_023350548.1 | putative HNHc nuclease | - |
| NF392_RS08920 | ssbA | 1874718..1875131 (-) | 414 | WP_049399325.1 | single-stranded DNA-binding protein | Machinery gene |
| NF392_RS08925 | - | 1875124..1875777 (-) | 654 | WP_023350550.1 | ERF family protein | - |
| NF392_RS08930 | - | 1875770..1875991 (-) | 222 | WP_023350551.1 | DUF2483 family protein | - |
| NF392_RS08935 | - | 1875957..1876238 (-) | 282 | WP_023350552.1 | hypothetical protein | - |
| NF392_RS08940 | - | 1876260..1876478 (-) | 219 | WP_023350553.1 | hypothetical protein | - |
| NF392_RS08945 | - | 1876956..1877168 (-) | 213 | WP_002436465.1 | DUF771 domain-containing protein | - |
| NF392_RS08950 | - | 1877172..1877339 (-) | 168 | WP_023350555.1 | hypothetical protein | - |
| NF392_RS08955 | - | 1877441..1877635 (-) | 195 | WP_023350556.1 | hypothetical protein | - |
| NF392_RS08960 | - | 1877718..1877894 (+) | 177 | WP_023350557.1 | hypothetical protein | - |
| NF392_RS08970 | - | 1878108..1878284 (-) | 177 | WP_023350559.1 | hypothetical protein | - |
| NF392_RS08975 | - | 1878367..1879137 (-) | 771 | WP_023350560.1 | DUF6551 family protein | - |
| NF392_RS08980 | - | 1879134..1880090 (-) | 957 | WP_049307539.1 | ParB N-terminal domain-containing protein | - |
| NF392_RS08985 | - | 1880106..1880345 (-) | 240 | WP_049399294.1 | helix-turn-helix domain-containing protein | - |
| NF392_RS08990 | - | 1880539..1880868 (+) | 330 | WP_002469947.1 | helix-turn-helix domain-containing protein | - |
| NF392_RS08995 | - | 1880880..1881341 (+) | 462 | WP_023350564.1 | ImmA/IrrE family metallo-endopeptidase | - |
| NF392_RS09000 | - | 1881360..1881884 (+) | 525 | WP_023350565.1 | Ltp family lipoprotein | - |
| NF392_RS09005 | - | 1881899..1882546 (+) | 648 | WP_023350566.1 | hypothetical protein | - |
| NF392_RS09010 | - | 1882606..1883667 (+) | 1062 | WP_023350567.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 137 a.a. Molecular weight: 15558.23 Da Isoelectric Point: 8.5209
>NTDB_id=714268 NF392_RS08920 WP_049399325.1 1874718..1875131(-) (ssbA) [Staphylococcus capitis subsp. capitis strain H17]
MINRFIGVGRLTKDPEFRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQADNVNKFLTKGSLAGVEGRIQTR
SYENNEGRRIFVTKVVCDSVQFLDTKNNNGNNNRQQTEQTQQEKPFDNGNDFPDLPF
MINRFIGVGRLTKDPEFRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQADNVNKFLTKGSLAGVEGRIQTR
SYENNEGRRIFVTKVVCDSVQFLDTKNNNGNNNRQQTEQTQQEKPFDNGNDFPDLPF
Nucleotide
Download Length: 414 bp
>NTDB_id=714268 NF392_RS08920 WP_049399325.1 1874718..1875131(-) (ssbA) [Staphylococcus capitis subsp. capitis strain H17]
ATGATTAATCGTTTTATAGGTGTAGGAAGATTAACAAAAGATCCAGAATTCAGAACAACGCCAAATGGTGTCAGTGTGAC
AACTTTTACAATCGCAGTGAATAGAACGTTCACTAATGCTCAAGGAGAGCGTGAGGCTGATTTTATTAACTGTGTAACGT
TCAGAAAACAAGCTGATAACGTAAATAAGTTTTTAACAAAAGGGTCACTTGCAGGCGTTGAAGGTCGCATTCAAACGCGT
AGTTACGAAAACAATGAAGGTAGACGCATTTTTGTCACTAAGGTTGTGTGTGATAGCGTTCAGTTTTTAGATACAAAAAA
TAACAACGGAAATAATAACCGACAACAAACAGAACAAACGCAACAAGAGAAACCATTTGATAATGGCAACGATTTTCCTG
ACCTTCCTTTTTAA
ATGATTAATCGTTTTATAGGTGTAGGAAGATTAACAAAAGATCCAGAATTCAGAACAACGCCAAATGGTGTCAGTGTGAC
AACTTTTACAATCGCAGTGAATAGAACGTTCACTAATGCTCAAGGAGAGCGTGAGGCTGATTTTATTAACTGTGTAACGT
TCAGAAAACAAGCTGATAACGTAAATAAGTTTTTAACAAAAGGGTCACTTGCAGGCGTTGAAGGTCGCATTCAAACGCGT
AGTTACGAAAACAATGAAGGTAGACGCATTTTTGTCACTAAGGTTGTGTGTGATAGCGTTCAGTTTTTAGATACAAAAAA
TAACAACGGAAATAATAACCGACAACAAACAGAACAAACGCAACAAGAGAAACCATTTGATAATGGCAACGATTTTCCTG
ACCTTCCTTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
71.028 |
78.102 |
0.555 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
57.547 |
77.372 |
0.445 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
55.66 |
77.372 |
0.431 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
39.394 |
96.35 |
0.38 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
39.394 |
96.35 |
0.38 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
38.636 |
96.35 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
38.636 |
96.35 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
38.636 |
96.35 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
38.636 |
96.35 |
0.372 |
| ssbB/cilA | Streptococcus mitis SK321 |
37.879 |
96.35 |
0.365 |
| ssbA | Streptococcus mutans UA159 |
37.879 |
96.35 |
0.365 |