Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   M8962_RS08135 Genome accession   NZ_CP097591
Coordinates   1746744..1746884 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain UA0188     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1741744..1751884
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M8962_RS08110 - 1742048..1742446 (+) 399 WP_003152031.1 DUF1694 domain-containing protein -
  M8962_RS08115 - 1742543..1743094 (+) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  M8962_RS08120 - 1743112..1744578 (+) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  M8962_RS08125 - 1744708..1745931 (+) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  M8962_RS08130 - 1745938..1746279 (-) 342 WP_012118316.1 hypothetical protein -
  M8962_RS08135 degQ 1746744..1746884 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  M8962_RS08140 - 1747092..1747952 (+) 861 WP_012118315.1 polyprenyl synthetase family protein -
  M8962_RS08145 comX 1747921..1748094 (+) 174 WP_012118314.1 competence pheromone ComX -
  M8962_RS08150 comP 1748108..1750408 (+) 2301 WP_012118313.1 histidine kinase Regulator
  M8962_RS08155 comA 1750489..1751133 (+) 645 WP_003152052.1 response regulator transcription factor Regulator
  M8962_RS08160 - 1751155..1751538 (+) 384 WP_012118312.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=690774 M8962_RS08135 WP_003152043.1 1746744..1746884(+) (degQ) [Bacillus velezensis strain UA0188]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=690774 M8962_RS08135 WP_003152043.1 1746744..1746884(+) (degQ) [Bacillus velezensis strain UA0188]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891